KEGG   Clostridium botulinum BKT015925: CbC4_0029Help
Entry
CbC4_0029         CDS       T01475                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00260  Glycine, serine and threonine metabolism
cbn01100  Metabolic pathways
cbn01110  Biosynthesis of secondary metabolites
cbn01120  Microbial metabolism in diverse environments
cbn01230  Biosynthesis of amino acids
Module
cbn_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CbC4_0029
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CbC4_0029
Enzymes [BR:cbn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CbC4_0029
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: AEB74712
Position
24226..25716
Genome map
AA seq 496 aa AA seqDB search
MDNIFYKSTRGGENNIRSTEAILKGIAEDGGLFVPNNIPKIDKSLKELINMNYKELAYLV
MSKFFTDFTESELKDCIEKAYDDKFDTIDIAEIKKDSNNLFLELYHGPTLAFKDMALSIL
PYLLTTAAKKENIKKEIVILTATSGDTGKAALEGFTNVDGTKIIVFFPEDGVSEIQKKQM
VTHEGNNTYVIGIKGNFDDAQSGVKKIFTDEKFIKLLDSNDYMFSSANSINIGRLIPQVV
YYFYGYLKLCKIDEIVLGEEINVTVPTGNFGNILAAYYAKKMGLPIKKLICASNDNKVLY
EFIKTGKYDKLREFVTTISPSMDILISSNLERLLYSISGEDTNKIRECMKSLDVNGKYVI
TDEMKKELNDFYGNFASESETRKSINEVYNNSKYLMDTHTAVAYCVNEKYKKESGDTTKS
LIISTASPYKFTYAVMNSLDNRFEQFSDFKLIKEMNKVIGQNEPRAIKNIEKKMIIHKTI
CNKEEMESEVKKILGI
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atggataatattttttataaaagtacaaggggaggagagaataacataaggtccactgaa
gctattttaaagggaattgctgaagatggaggattatttgttccaaataatatccctaaa
atagataagtctttaaaagaactaattaatatgaattataaagaacttgcttacttggtt
atgagtaaatttttcactgattttactgaaagtgaattaaaagattgcatagaaaaagct
tatgatgataagtttgatactatagatatagctgagataaaaaaagattctaataattta
tttttagagttgtatcatggaccaacattagcttttaaagatatggcattatctatacta
ccatatcttttaactacagcagcaaagaaagagaatataaagaaagagattgtaatactt
acggcgacttcaggtgatacaggaaaagcagcgcttgaagggtttacaaatgtggatggc
actaaaatcatagtattttttccggaggatggagtaagtgaaattcagaaaaaacaaatg
gttacacacgagggaaataacacttatgtaataggaataaagggtaactttgatgatgct
caaagtggggttaaaaaaatatttactgatgaaaaatttataaagcttttagatagcaat
gattatatgttttcttctgctaattccataaatataggtagactaatacctcaagtagta
tattatttttacggatatttaaagctttgcaaaatagatgaaatagttttaggtgaagaa
ataaatgtaactgttcctacaggaaactttggaaatatacttgcagcatattatgctaaa
aaaatgggtcttcccataaaaaaattaatatgtgcatctaatgataataaagttttgtat
gagtttataaagacgggtaagtatgataaattaagagaatttgttacaacaatatctcca
tctatggacattttaatatcaagtaatttagaaaggcttttatatagtataagtggagaa
gacacaaacaagataagagaatgcatgaagagtttagatgttaatggaaagtatgttata
actgatgaaatgaaaaaagaacttaatgatttttatggtaattttgcatctgagtcggag
acaaggaaatcaataaatgaagtttataataatagcaagtatttaatggatactcatacg
gctgttgcttattgtgttaatgaaaaatataaaaaagagtcaggagatactacaaaatcc
ttaataatttctactgcaagtccatataagtttacttatgcagttatgaattcattagat
aatagatttgaacaatttagtgattttaagttgatcaaagaaatgaataaggtaatagga
cagaatgaaccaagggctataaagaatatagaaaagaaaatgattattcataaaactatt
tgcaataaagaagagatggaatcagaggtaaagaaaattttaggaatttaa

DBGET integrated database retrieval system