KEGG   Clostridium botulinum BKT015925: CbC4_0077Help
Entry
CbC4_0077         CDS       T01475                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CbC4_0077
Enzymes [BR:cbn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     CbC4_0077
Peptidases [BR:cbn01002]
 Cysteine Peptidases
  Family C44
   CbC4_0077
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
72256..74121
Genome map
AA seq 621 aa AA seqDB search
MCGFLQVFKRNISKREMSILREAAKTIVHRGPDDTKEVIHNNAAFIFNRLSIIDIESGTQ
PFIYKNRYTVVFNGEIYNYKELRDEILCKNGHFKTNSEVEVIAALYDDIKGDIVNKLRGM
FAVIIYDKLEEKIVAFRDEFGIKPLYYMEMNDGLYFSSDIKGLIEMSSSLTYMSDLIGEY
ATYQYIPSSNSTIFNEIKILQQGHILEKKLDGKINIHKYFHVVFNEKQHDKETLKKQIKD
TVKESVRLHLQSDVPVATFLSSGIDSSIVTKIASEINPNIVSYTIGFDVEGYDETEYAKK
FAEYLGIKNVSIKLNYKDYVRELPKIIYHMDSPIGDPSIIPLYYICKEASKDYKVILSGE
GSDEFFGGYNIYTEDESLKIFNYFPKFIKTIANKIGGKLPDNIKGKSFILRGTTPLEKRY
CGNANIFNNEEKRKVFNNYKSSRNYLRITEELFKDVSEKDNITKRQYIDINTWLVGDILT
KADRMSMANSLEVRVPFVDKEVFKLGSTLSKNDKVQGFTTKVMLREAFKDELPGDLYNKK
KLGYPVPIRVWLKDELYDWAYNIIKNNPVGEINEEAVINMLNRHKDGKGDYSRKIWSIIV
YILWYRLYIDKSLHKEYLFKL
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggatttttacaagtgtttaagaggaatatatcaaagagagagatgtctatttta
agagaagcagcaaagactatagtacatagaggaccagatgatactaaagaagttatacat
aataatgcagcgtttatatttaataggttaagtattattgatattgaaagtggaactcag
cctttcatttataaaaatagatatacagttgtttttaatggtgaaatatataattataaa
gaattaagagatgaaattttgtgcaaaaatggtcattttaaaacaaattcagaagttgaa
gtaatagcagcactttatgatgatataaaaggggatattgtaaataagcttaggggaatg
tttgcagtaataatatatgataaattagaagagaaaattgtagcttttagagatgagttt
ggaataaaaccattgtattatatggagatgaatgatggattatatttttcatcagatatt
aaaggattaatagaaatgagtagtagtcttacatatatgagtgatttaattggtgaatac
gcaacgtatcaatatattccatcaagtaatagtactatatttaatgaaataaaaatattg
caacaaggacatattttagagaaaaaattagatgggaaaattaacatacataagtatttt
catgtagtatttaatgaaaaacaacatgataaagaaacgttaaagaaacaaataaaagat
acagtaaaggaatcggtgagacttcatctacaaagtgatgtaccagttgctactttttta
tctagtggtatagattcatcaatagttactaaaatagctagtgagataaatccgaatatt
gtttcgtatactataggatttgatgtagaagggtatgatgagactgaatatgcaaagaag
tttgcggagtatttaggaattaaaaatgttagtataaaacttaattataaagactatgta
agagagcttcctaaaataatatatcatatggatagtccaattggtgatccttcaataata
ccactttattatatttgtaaggaagcaagtaaagattataaagtaatattatcaggagaa
ggatcagatgagttttttggaggatacaatatatatactgaggatgaatcattaaaaata
tttaattattttcctaagtttataaaaaccatagcaaataaaataggtggtaaattacca
gataatattaaaggaaaaagttttattttaaggggtacaactccattggaaaaaagatat
tgtggaaatgctaatatatttaataatgaagaaaaaagaaaagtatttaataattataaa
tcatcaagaaattacttaaggataacagaagagttatttaaagacgtatcagaaaaagat
aatataacaaagaggcaatacattgatataaatacttggcttgttggagatatattgact
aaggcagatagaatgtctatggcaaattcattagaagttagagttccttttgttgataaa
gaagtatttaaattaggatcaactttaagtaaaaatgacaaagttcaaggatttacaaca
aaagttatgcttagagaagcatttaaggatgaacttccaggggatttatataataagaaa
aagttaggatatccagttcctataagagtatggcttaaggatgaactttatgattgggca
tataatattataaaaaataatcccgtaggtgaaataaatgaggaagcagttattaatatg
ctaaataggcataaagatggaaaaggggattactcaagaaagatatggagtattatagtg
tatatattatggtatagactttatatagataaatcgttacataaagaatatttatttaaa
ttataa

DBGET integrated database retrieval system