KEGG   Clostridium botulinum BKT015925: CbC4_0089Help
Entry
CbC4_0089         CDS       T01475                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CbC4_0089 (malQ)
Enzymes [BR:cbn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     CbC4_0089 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
86856..88334
Genome map
AA seq 492 aa AA seqDB search
MFKRSSGILMHITSLPGSYGIGTFGKEAYNFIDFLVKSGQKYWQVLPLGPTGYGDSPYQS
FSAFAGNPYLIDLDLLYDDKLIQKSDYENVDFGNEEESVDYEKIEKNKMPILRKAFKNSK
DKYSNEIKKFKEENHEWIEDYALYMALKHKYNLKSWRVWDENIKLRKKEAIKKAIKELKD
EIDYNIFLQFIFYKQWRELKKYANKNGIKIIGDIPIYVAEDSADTWANSEIFLLDEDKRP
KVVSGCPPDGFSPTGQLWGNPIYDWDYLEKTNYEWWIKRIRFNSKLYNVTRIDHFRGFES
YWQIPYGEKTAINGKWVKGPAMKLFNMVKKELGEVKIIAEDLGYLTEDVRAFREATGYPG
MKVLEFAFDTREESDYLPHNYNKECVVYTGTHDNDTVNGWFENTQKSDVDFAIKYLKLNK
EEGYNWGFIRGALSSVGNLAIAQLQDYLGLGTEARMNIPSTLGGNWKWRARKQDINENLR
KKVYEITKLYGR
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaaagaagtagtggtattttaatgcatataacttctttaccaggttcctatgga
ataggtacatttggaaaagaagcatataattttatagattttttagtgaaatcaggacaa
aagtattggcaagtattgcctcttggtcctactggatatggggattcaccatatcaatca
ttctctgcttttgcaggaaatccatatcttatagatttagatttattatatgatgataaa
ttaatacagaaaagtgattatgaaaatgtggattttggaaatgaagaagaatcagtagat
tatgaaaaaatagagaaaaataaaatgcctattttaagaaaggcttttaaaaattctaaa
gataaatatagtaatgagataaaaaagtttaaagaagaaaatcatgagtggatagaagat
tatgctttatatatggctttaaagcataaatataacttgaaatcatggagggtttgggat
gaaaatataaagttaagaaaaaaagaagcaataaaaaaagctataaaagagcttaaagat
gaaatagattataatatattcttacagtttatattttataaacaatggagagaattaaag
aaatatgctaataaaaacggaattaagataattggggatatcccaatttatgttgcagaa
gatagtgcagatacttgggctaatagtgaaattttcttactagatgaagataaaaggcca
aaagttgtttcaggatgtcctccagacggattttcaccgactggacagttatggggaaat
ccaatatatgattgggattatttagagaaaacaaattatgagtggtggataaagagaatt
agatttaatagtaaattatataatgtaacaagaatagatcatttcagagggtttgaatcg
tattggcaaataccctatggagaaaagacagctataaatggtaaatgggtaaaaggacct
gctatgaagctatttaatatggtaaaaaaagaacttggagaagtgaaaattatagcagaa
gatttgggctatttaactgaagacgttagagcttttagagaagccactgggtatccaggg
atgaaggtattagaattcgcttttgatactagagaggaaagtgattatcttccccataat
tataacaaggaatgtgttgtatatactggtacccatgataatgatactgttaacggatgg
tttgaaaatacccaaaagagtgatgttgactttgctataaaatatttgaaacttaataaa
gaagaaggatataattggggatttataagaggtgcattaagttctgttggtaatcttgca
atagctcagcttcaagattatttagggcttggaacagaagcaagaatgaatattccatca
acattaggtggaaactggaagtggagagcaagaaaacaagatataaatgaaaatctaaga
aaaaaggtctatgaaatcacaaaattgtatggaaggtag

DBGET integrated database retrieval system