KEGG   Clostridium botulinum BKT015925: CbC4_0185Help
Entry
CbC4_0185         CDS       T01475                                 

Gene name
panC
Definition
pantoate--beta-alanine ligase (EC:6.3.2.1)
Orthology
K01918  
pantoate--beta-alanine ligase [EC:6.3.2.1]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
beta-Alanine metabolism
Pantothenate and CoA biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:cbn00410]
Metabolism; Metabolism of cofactors and vitamins; Pantothenate and CoA biosynthesis [PATH:cbn00770]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
195669..196520
Genome map
AA seq 283 aa AA seqDB search
MISLNKVDDVRKYINKWREEGLSIGLVPTMGCLHEGHKSLIDRAVKENDKVVVSVFVNPT
QFGPDEDFNKYPRNLKSDMDICKKAGVSIIFNPNYSEMYCNDGSTYVNVEKLTEGLCGAK
RQGHFKGVCTVVNKLFNIVNPRRAYFGEKDAQQLAVIKRMVRDLNFNIDIIGCPIIREDD
GLAKSSRNKYLSYEERGAASILNKSLKYAKMSLENGERDVNKVKNIIKNKILEESLAKID
YIEIVDSVTLQNINIIERNILVAIAVFIGNTRLIDNFTFKLGV
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgataagtttgaataaagttgatgatgttagaaagtatattaataaatggagagaagag
ggattatctataggacttgtaccaactatggggtgtttacacgaagggcataaaagtctt
atagatagagcagtgaaagaaaatgataaagttgtcgttagtgtttttgtaaatcctact
caatttggaccagatgaagactttaataaatatccgaggaatttaaaaagtgatatggat
atttgtaaaaaggcaggggttagtataatttttaatccaaattattctgaaatgtattgt
aatgatggatctacctatgtaaatgtggagaaactaactgagggtttatgtggtgcaaaa
cgacaaggacattttaaaggggtgtgtacggtagttaataagctgtttaatatagttaat
ccaaggcgggcatattttggggagaaggatgctcaacagttagctgttataaaaaggatg
gttagagatttaaattttaatatagatataatagggtgtccaataataagagaggatgat
ggacttgctaaaagttctagaaataaatatctttcttatgaagagagaggggcagcatca
attcttaataagagtttaaaatatgcaaagatgagtcttgaaaatggagagagagatgtt
aacaaggtaaaaaatattataaaaaataaaatactagaagaatcacttgcaaagattgac
tatattgagattgttgatagtgttacattacaaaacattaatataatagaacgtaatata
cttgtagccattgctgtatttataggaaatactagattaatagataattttactttcaaa
ttgggggtataa

DBGET integrated database retrieval system