KEGG   Clostridium botulinum BKT015925: CbC4_0192Help
Entry
CbC4_0192         CDS       T01475                                 

Definition
Xaa-His dipeptidase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CbC4_0192
  Amino acid metabolism
   00300 Lysine biosynthesis
    CbC4_0192
Enzymes [BR:cbn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CbC4_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
201874..203283
Genome map
AA seq 469 aa AA seqDB search
MKGEGYMKINNLVENMRKDIIKSTQELISIKSVKEDPKENKPFGEGPAKALQYCLDLCNK
LGFKTTNLDNYIGYAEYGEGDEYVGVLGHVDVVPEGDGWLYPPYGAEIHDDKIYGRGTMD
DKGPMVACIYGLKAIMDAEIKLSNKIRIIFGTNEESGSEGEIERYFKSEKEPISGFTPDA
EYPIINGEKGLTTFDLVEKFNDEGKENSIVFIKGGQKANMVPDYCEAGILIKDSNIIIDA
AKKFIDKTGYDISVETKDEMVIIKSKGVAAHGSLPQLGKNAIMQLFMFISELQLEDCDIV
RFIKFMNKHIGMEVYGESFGVGLEDEVSGKLSFNVGVINLNHHEVTMTLNLRYPVTCKFE
DMMKGLNKTLSNTNIKVKNMQHQEPLYFSADNEIITTLSKVYEEQTGDKTKLLSIGGGTY
AKEMPNIVAFGPIFPGEPDLDHQANEYIKVDDLIKNAKIYAHAMYELAK
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaggagaaggatatatgaaaattaataatttagtagagaatatgaggaaagatata
ataaaatcaactcaagaattaatatctataaaaagtgttaaagaggacccaaaagaaaat
aagccttttggagaaggtcctgcaaaggcacttcaatattgcctggacttatgtaataaa
cttggatttaaaactacaaatttagataattacataggatatgcagaatatggtgaaggg
gacgaatatgtaggggttctaggacacgttgatgtagttccagaaggagatggatggtta
tatcctccttatggagcagaaatacatgatgataaaatatatggacgtgggactatggac
gataaaggaccaatggtggcttgtatatatggacttaaggcaataatggatgcggaaatt
aagctttcaaataaaataagaataatctttggaactaatgaagaaagtggttcagagggt
gaaattgaacgttattttaaaagtgaaaaggagccgatatcaggatttactccagatgct
gaatatccaattataaatggagaaaaaggattaactacttttgatttagtagaaaaattt
aacgatgaaggtaaagaaaatagtatagtttttataaaaggtggtcaaaaagctaacatg
gttcctgactattgtgaagcaggtatattaattaaggattctaatataattatagatgct
gcaaaaaagtttatagataaaacaggttatgatataagtgtagaaactaaagatgaaatg
gtaataataaaatccaaaggagttgcagctcatggtagtcttccacagcttgggaaaaat
gctataatgcaattatttatgtttataagtgaattacaattagaggattgtgatatagtt
agattcataaaatttatgaataagcatattggaatggaagtgtatggagaatcttttgga
gtaggacttgaagatgaagtatcaggaaaactttcttttaatgtaggagtaattaactta
aatcatcatgaagtaactatgacattaaatttaagatatcctgttacatgtaaatttgaa
gatatgatgaaaggtttaaataaaacattaagtaatacaaatataaaagttaaaaatatg
caacatcaagaacctttatatttctcagcagataatgagataattaccactttgtcaaag
gtttatgaggaacaaacaggtgacaaaaccaaacttttatcaattggaggaggaacttat
gctaaagaaatgccaaatatagttgccttcggaccaatatttcctggggaacctgaccta
gatcatcaagctaatgaatatataaaggttgatgatttaattaaaaatgctaaaatttat
gcccatgctatgtatgaacttgcaaaataa

DBGET integrated database retrieval system