KEGG   Clostridium botulinum BKT015925: CbC4_0324Help
Entry
CbC4_0324         CDS       T01475                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbn00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:cbn00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(329093..329590)
Genome map
AA seq 165 aa AA seqDB search
MISFVVAVDKNNLIGKNNTLPWHLPCDLKHFKEITLKESKTIIMGRKTFEALPNILPGRK
HIILTRNQNYAVNNANVEIIYNISQLTKFIKSHKEYFVIGGGKIFSMLLPYATKIYMTKI
NDSFDGDTFFPKLDMGQWQIVESFNGTLNSKNIYEHSFLTLYKKN
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgataagttttgtagttgctgttgataaaaataatcttataggaaaaaacaatacgctt
ccttggcatcttccttgtgatttaaaacactttaaagaaattacactaaaagaaagtaaa
acaataattatgggaagaaaaacttttgaagctttacctaacatacttccaggacgaaaa
cacataattttaactcgaaaccaaaactatgcagtcaataatgctaatgtagaaataata
tataacatttcccaattaactaaatttataaaaagtcataaagaatattttgttataggt
ggtggcaaaattttttctatgctcttaccatatgcgacaaaaatttatatgaccaaaata
aatgactcttttgatggtgatacctttttccccaaacttgacatgggtcaatggcaaatt
gtagaatcttttaatggaactctcaatagcaaaaatatatatgaacatagctttttaacc
ttatataaaaaaaactaa

DBGET integrated database retrieval system