KEGG   Clostridium botulinum BKT015925: CbC4_0354Help
Entry
CbC4_0354         CDS       T01475                                 

Definition
glycoside hydrolase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Galactose metabolism
Glycerolipid metabolism
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    CbC4_0354
  Lipid metabolism
   00561 Glycerolipid metabolism
    CbC4_0354
   00600 Sphingolipid metabolism
    CbC4_0354
Enzymes [BR:cbn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     CbC4_0354
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
361221..363410
Genome map
AA seq 729 aa AA seqDB search
MGIKFDCKNKVFYLNSKEMSYIMQIDKIGNLVHLYWGKKIRVCNPESLLQFTIRDYVSYP
YKEDKKISLDILPQEYPSYGTSDYRTPAYQVEAKDGSTISEAKYKSHKIFKGKVAIKGLP
STYVMEENEAETLEIELYDEILKLKIKLCYTIYEEFNVITRSVCFINESDNDIKILKALS
SSVDFKDNKFDLMHLTGAWARERYIEKIPLGINSQIIDSKRGASGHQQNPFVALLRKDTD
EDHGEVYGFNLVYSGNFIAQAEVDQFKTCRLSMGINPFDFSWLLEPKEEFQTPEVVMVYS
DEGLGKMSRTYHKLYRTRLCRGFFKEKERPILVNNWEATYFDFNEEKLLDIAKEGKKLGI
ELFVLDDGWFGKRDSDKCSLGDWVENKRKLPKGLKGIAEDINNLGMKFGLWVEPEMISPD
SELYREHPDWCLHVKDRRRSESRNQLILDFSRNDVCDYIISTLSKVFSSANIGYVKWDMN
RNMTEIGSSLLPSKRQRETAHRYILGLYRVMETIVTKFPSILFEGCAGGGGRFDPAILYY
MPQIWTSDNTDAIARLKIQYGTSIVYPPIMMTAHVSAVPNHQVGRITPLKTRGDVAMFGN
LGYELDLTELKNEEKEEVKKQISNYKDIRKLVQFGEVYRLISPFNENKASWIIVSEDKSE
FIVYFYRMLMEPNAEFERLKLKGIDPNKKYKLIESNSIYFGDELMFLGIPITCRHKDFES
VVLRFKAIN
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgggaattaaatttgattgtaaaaataaagtgttttatttaaactctaaagaaatgagt
tatataatgcagatagacaaaatcggaaatcttgttcatttgtattggggcaagaaaata
agggtttgtaatccagagagtttattgcaatttactataagagattatgtatcttatcca
tacaaagaagacaaaaaaatttcgttagatatattaccacaagaatatccatcgtatgga
acgtctgattataggacacctgcttatcaagttgaggcaaaggacggttcaacaatatct
gaagctaaatataaatcacataaaatatttaaaggaaaggtagcaataaagggattacca
tcaacatatgttatggaagaaaatgaggcggaaacactagaaatagaattatatgatgaa
atattaaaattaaaaataaaactttgttatacgatatatgaagaatttaatgtaataact
agatcggtttgttttataaatgaatcagacaatgatataaaaattttaaaagcgttaagt
tccagtgtagattttaaagataataaatttgacttaatgcatcttacaggggcttgggca
agagaaaggtacattgaaaaaatacctcttggaattaattctcagattattgatagtaaa
agaggagcaagtggtcatcaacaaaatccatttgttgcattattgagaaaggatacagac
gaagatcatggagaagtatatggatttaatcttgtgtatagtggaaattttattgcacaa
gcagaggttgatcaatttaagacatgtagactatcaatgggcataaatccttttgatttt
agttggttattagagccaaaagaagaattccaaacaccagaggtagttatggtttattca
gatgaaggacttgggaaaatgtccagaacatatcataaattatatcgtactagattgtgc
agaggtttttttaaagaaaaagagagaccaatacttgttaataattgggaagctacttat
tttgatttcaatgaagaaaaattattagatattgcaaaagaagggaaaaaactaggaatt
gaattatttgttttggatgatgggtggttcggaaaaagggatagtgataaatgttcttta
ggggattgggttgagaataagagaaagctacctaaaggattaaaaggaattgctgaagat
ataaataatttaggaatgaagtttggattatgggtagaaccagaaatgatttcaccagat
agtgaactttatagagaacatccagactggtgtttacatgtaaaggatagaaggagatca
gaatccagaaatcaattgattttagatttttcaagaaatgatgtatgtgattatattata
agtactttatccaaagtgttttctagtgcaaatataggttatgttaagtgggacatgaat
agaaatatgacagaaatagggtcatcattattgccttcaaaacgacaacgtgaaacggct
catagatacattttgggattgtatagagtaatggagactatagtaacgaagtttccaagc
atactatttgagggatgtgcaggaggcggaggtcgatttgatccagctatattatattat
atgcctcaaatatggacaagcgataacacagatgctatagcaaggctaaagattcaatat
ggaacaagtatagtatatcctcctattatgatgacagctcatgtatcagcggttccgaat
catcaggttggaaggataacacctttaaaaactcgtggagatgtagctatgtttggaaat
ctaggatatgagttagatcttactgaattaaaaaatgaagaaaaagaagaagtgaaaaaa
caaattagtaattataaagatataagaaaattggttcaatttggagaagtatatagatta
attagcccatttaatgaaaataaggcatcatggattattgtatccgaagataaaagtgag
tttatagtatatttttatagaatgcttatggaaccaaatgctgaatttgagagattaaaa
ttaaagggaattgatccaaataagaaatataaattaatagaaagtaattctatttacttt
ggagatgaattaatgtttttaggaataccaattacttgcagacataaagattttgaaagt
gtagttttaagatttaaagctataaattag

DBGET integrated database retrieval system