KEGG   Clostridium botulinum BKT015925: CbC4_0446Help
Entry
CbC4_0446         CDS       T01475                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:cbn01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:cbn01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbn00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:cbn00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:cbn00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:cbn00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:cbn00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
473021..473980
Genome map
AA seq 319 aa AA seqDB search
MKTIAVLTSGGDAPGMNAAIRAVVRTGLDKGLKVMGIQRGYSGLINGEIFEMNRQSVADI
IHRGGTILRTARCEEFKTEAGRKKGVGILKAFGIDGVVVIGGDGSFQGAQLLSKLGVKTI
GIPGTIDNDLAYTDYTIGFDTATNTVLDAINKLRDTSSSHERVSIVEVMGRGCGDLALFA
GIGGGAESVIVPEKEFNEDELCKKILEGKLRGKLHNLIILAEGVGGGEALTKKVQEVTGI
QTRLTTLGHIQRGGSPSAFDRVLSCRLGAKAVELLIEGKSSRVVGLRNNKVVDDDIDEAL
SMESKFDDDLYDIAEILSY
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattgctgttttaacaagtggtggagatgccccaggaatgaacgccgcaata
agagcggttgtaagaacagggctagacaaaggtctcaaagtaatgggaatacaaagaggg
tacagtggattaataaatggggaaatttttgaaatgaaccgtcaaagtgttgctgatata
atacatagaggcgggacaattttgagaacagctcgttgcgaagaatttaaaactgaagct
ggtagaaaaaaaggcgttggaattctaaaagcttttggaattgatggagttgtagttata
ggtggagatggatctttccaaggcgcacaattgctatcaaaattaggtgttaaaactata
ggaataccaggaactatagataatgacttagcttatacagattatactataggatttgat
acagcaactaacactgtgttagatgctattaacaaattaagagatacttcatcttctcat
gaaagagttagtatagttgaagttatgggaagaggttgtggagatttagctttatttgct
ggaattggtggtggcgctgaaagtgtcatagtaccagaaaaagaattcaatgaagatgaa
ttatgcaaaaagatattagaaggtaaattaagaggaaaacttcacaatttaataatccta
gctgaaggtgtaggtggaggagaagctctaactaaaaaagtacaagaagtaacaggaata
caaactagattaacaactctaggacatatacaaagaggaggaagtccttcagcatttgat
agagttttatcatgtagattaggagctaaagctgttgaacttttaattgaaggaaaatct
tcaagagtagttggtttaagaaataataaggtggttgatgatgatatagatgaagcatta
tcaatggaaagtaaatttgatgatgatttatatgatatagcagaaatactatcttattaa

DBGET integrated database retrieval system