KEGG   Clostridium botulinum BKT015925: CbC4_0573Help
Entry
CbC4_0573         CDS       T01475                                 

Gene name
tpiA
Definition
(RefSeq) Triose-phosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbC4_0573 (tpiA)
   01230 Biosynthesis of amino acids
    CbC4_0573 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbC4_0573 (tpiA)
   00051 Fructose and mannose metabolism
    CbC4_0573 (tpiA)
   00562 Inositol phosphate metabolism
    CbC4_0573 (tpiA)
Enzymes [BR:cbn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CbC4_0573 (tpiA)
Exosome [BR:cbn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CbC4_0573 (tpiA)
  Exosomal proteins of bladder cancer cells
   CbC4_0573 (tpiA)
  Exosomal proteins of melanoma cells
   CbC4_0573 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
615649..616401
Genome map
AA seq 250 aa AA seqDB search
MRKAIIAGNWKMNNTISQGVKLVEELKPLVADANCDVVVCPSTLCLDAIVKATEGTNIKV
GAQNMHFEESGAFTGETAPAMLEELGVKYVILGHSERRQYFGENDADLNKKMKKAFEHNL
TPILCIGETLEEREADVTEEVLAKQIKLDLAGLTKEQIEETVIAYEPIWAIGTGKTATSD
QAEETIAFVRKTVAGMFGAEAAEKMRIQYGGSVKPATIKEQMAKPNIDGGLIGGASLKAA
DFAGIVNFDK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagcaattatagcaggaaactggaaaatgaacaatacaatttcacaaggagtt
aaacttgttgaagaattaaaaccattagtagcagatgcaaactgtgatgtagtagtttgt
ccatcaactttatgtttagatgcaatagtaaaagctactgaaggaactaatataaaagtt
ggagctcaaaacatgcactttgaagaaagtggagcatttacaggagaaactgcaccagct
atgcttgaagaattaggagtaaaatacgttatattaggacatagtgaaagaagacaatac
ttcggagaaaatgatgctgacttaaacaaaaaaatgaagaaagcatttgaacataattta
actccaatcctttgcataggagaaactttagaagaaagagaagcagatgttactgaagaa
gtacttgcaaaacaaatcaaacttgatttagcaggacttactaaagaacaaatcgaagaa
actgtaatagcttatgaaccaatctgggctattggaacaggaaaaactgctacatctgat
caagcagaagaaactatagctttcgtaagaaagacagttgcaggtatgtttggagctgaa
gctgctgaaaaaatgagaatccaatacggtggatctgttaaaccagcaactataaaagaa
caaatggcaaaaccaaacatagatggtggtcttataggtggagcttcacttaaagctgct
gattttgctggaatagtaaactttgataaataa

DBGET integrated database retrieval system