KEGG   Clostridium botulinum BKT015925: CbC4_0689Help
Entry
CbC4_0689         CDS       T01475                                 

Definition
fructose-1,6-bisphosphatase (EC:3.1.3.11)
Orthology
K04041  
fructose-1,6-bisphosphatase III [EC:3.1.3.11]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbC4_0689
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbC4_0689
   00030 Pentose phosphate pathway
    CbC4_0689
   00051 Fructose and mannose metabolism
    CbC4_0689
  Energy metabolism
   00680 Methane metabolism
    CbC4_0689
Enzymes [BR:cbn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     CbC4_0689
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(748633..750630)
Genome map
AA seq 665 aa AA seqDB search
MTFCDENNLDLIKRDLRYLKLLAKQYPDISSASTEIVNLQAILNLPKSTEHFLSDIHGEY
ESFTHVLKNASGVIKRKIDDVFGNSLRDSEKLTLATVIYYPEQKLELIKQCEKDLSDWYK
ITLYRLIELCRAVSSKYTRSKVRKALPHDFAYIIEELLHEHDGTINKQEYYNGIISTIID
IDRAPEFITAISKVIQRLVVDRLHIIGDIYDRGPGAEIILEALMKHHSVDIQWGNHDILW
MGAAAGSEACICNVLRISLRYANLNTIEDGYGINLLPLATFAMDIYENDPCNSFIPKTIN
KELTQNEINLISKMHKAISIIQFKLQGQIIKNHPEFKMDDQLLLDKINYEKGTISLDGNI
YKLNDTVFPTIDPKNPYTLTPGEDDLIKKITKSFVNSEKLQRHIRFLYSKGSMYLIYNSN
LLYHGCIPLNEDGTFKEVTIDGKKYFGKSLLDKFDCLAREAFFFKEDSRLKKFAMDMVWY
LWCGPNSPEFGKYKMATFERYFIDNEGTHIEYRNPYYKYRSNEKVVINILKEFGLDPNCS
HIINGHIPVKTKAGENPIKANGKLLVIDGGFCRAYQPETGIAGYTLIYNSYGLLLSSHEP
FSSIRKAIEEEKDILSSTIILEQVVSRKRVSDTDIGKNLKKQIRELEMLLIAYRKGLIKE
QNSEK
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atgaccttctgtgacgaaaataatttagatttaattaaaagggatttaagatatttgaag
ttgctcgcaaaacaatatccagatatctcatcagcaagtactgaaatagtaaacttgcaa
gctatcttaaatttacctaaaagtacagaacactttttaagtgacattcatggagaatat
gaatcttttactcatgtacttaaaaatgcttctggagttattaagcgtaaaatagatgat
gtttttggaaactctctaagagatagtgaaaaattaactttagcaacagtaatttattat
cctgagcaaaagttagaacttataaagcagtgtgaaaaggatttaagtgattggtacaag
ataactttgtacaggctaattgaactttgtagagcagtttcttctaaatatacacgttct
aaagttagaaaagctttaccacatgattttgcttatataatagaagaattacttcacgaa
cacgatggaacaattaacaaacaagagtattataatggtataatctcaactatcattgac
attgatagagcacccgaatttataactgctatctccaaagtcattcaaagacttgtagta
gatagacttcatattataggagatatttatgatagaggtcctggtgcagaaattatacta
gaagctttaatgaaacatcattcagtagatattcaatggggaaatcatgatattttgtgg
atgggtgcagcagctggttctgaagcttgtatctgtaatgttcttagaatttctctaaga
tatgctaatttaaacacaattgaagacggttacggtattaatttacttcctcttgctaca
tttgctatggatatttatgaaaatgatccttgtaatagttttattcctaaaactattaat
aaagaacttactcaaaatgaaattaatctaatatcaaaaatgcataaggcaatatcaata
attcaatttaaacttcaaggacaaattattaaaaatcatcctgagtttaagatggatgat
cagttgcttcttgataagattaattatgaaaaaggaactataagtcttgatggaaatata
tataaattaaatgatactgtttttcctactatagatcctaaaaatccttatactttaaca
cctggagaagatgatttaattaaaaaaataactaaatcatttgtaaacagtgagaagctt
caacgccatattcgttttctttatagtaaaggttcaatgtaccttatttataattcaaat
ttactatatcacggatgtattccacttaacgaagacggaacttttaaagaagtgactata
gatggtaaaaaatactttggtaaatctcttttagacaaatttgattgtcttgcaagagaa
gcatttttctttaaggaagattctcgacttaaaaagtttgctatggatatggtatggtac
ttatggtgtggtcctaattcacctgaatttggtaaatataaaatggctacatttgaaaga
tatttcatagataatgaaggaactcatatcgagtatagaaacccatattacaaatataga
tcaaacgaaaaagtcgttattaacatattaaaagaatttggacttgatcctaattgttct
catataattaatggacatattcctgttaaaactaaagctggtgaaaatccaattaaagct
aatggtaaattgctagttattgatggtggtttttgtagagcatatcaacctgagacaggc
attgcgggatatactttgatttataattcttatggacttttattaagttctcatgaacct
ttttcatctataagaaaagctattgaagaagaaaaagatatattatcatctactattata
cttgaacaagttgtatcaaggaaaagagtttctgatacagatataggaaaaaatttaaaa
aaacaaatacgagaacttgaaatgttattaattgcatatagaaaaggtcttattaaagaa
caaaattcagaaaaatag

DBGET integrated database retrieval system