KEGG   Clostridium botulinum BKT015925: CbC4_0721Help
Entry
CbC4_0721         CDS       T01475                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CbC4_0721 (galU)
   00052 Galactose metabolism
    CbC4_0721 (galU)
   00500 Starch and sucrose metabolism
    CbC4_0721 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    CbC4_0721 (galU)
Enzymes [BR:cbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CbC4_0721 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(791775..792650)
Genome map
AA seq 291 aa AA seqDB search
MNVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEEILIITGRNK
RAIEDHFDKSVELELQLENNNKKDLLDMVRSISNMVDIHYIRQKEPKGLGHAISCAKTFV
GNEPFAVMLGDDVVDSKVPCLKQLINCFNEYKTSILGVQKVPKENVCKYGIVDGLHIEDK
VYKVKHLVEKPSVDEAPSDVAILGRYIITPEIFNILENTAPGKGGEIQLTDALCTLIKNE
AMYAYCFDGRRYDVGDKLGFLEATIEFALKREDLKGPFIEYLKSIEKNFTN
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
ttgaacgtaaaaaaagctataattccagcagcaggtcttggaacaagatttttacctgca
actaaagctcaaccaaaggaaatgttacctatagttgataagcctactatacagtatata
atcgaggaagcggtagcatctggtatagaagagatattaattataactggaagaaataaa
cgagctatagaagaccattttgataaatccgtagaacttgaattacaacttgaaaataac
aataaaaaagatttgctagatatggttcgtagcatttcaaatatggtagatattcattac
ataagacaaaaagaacctaaaggtcttggacatgctataagttgtgctaaaacttttgta
ggaaatgaaccttttgctgttatgcttggagatgatgttgtagatagtaaagttccttgt
ttaaaacagcttataaattgctttaatgaatataaaacaagcatacttggggtacaaaaa
gttcctaaagaaaatgtatgtaaatatggaattgtagatggtctacatattgaagataaa
gtttataaagtaaaacatttagttgaaaagccttccgttgatgaagccccatctgatgtt
gctattcttggaagatacataattactccagaaatttttaatattctagaaaatactgcg
cctggaaaaggtggagaaattcaacttacagatgccctttgtactttaattaaaaatgaa
gctatgtatgcttattgcttcgatggaagacgatatgatgttggagataaactaggattt
cttgaagccactatagaatttgcactaaaaagagaggatcttaaaggaccatttatagag
tatcttaaatccatagaaaaaaactttactaattaa

DBGET integrated database retrieval system