KEGG   Clostridium botulinum BKT015925: CbC4_0909Help
Entry
CbC4_0909         CDS       T01475                                 

Definition
1-phosphofructokinase (EC:2.7.1.56)
Orthology
K00882  
1-phosphofructokinase [EC:2.7.1.56]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Fructose and mannose metabolism
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    CbC4_0909
Enzymes [BR:cbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.56  1-phosphofructokinase
     CbC4_0909
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997923..998834
Genome map
AA seq 303 aa AA seqDB search
MIYTIAFNPALDYVIKVEDLRLGNLNRTDFEGVYPGGKGINVSIVLNNLGIENVAFGYIA
GFTGVEIEKRVNELGCATDFIKLDTGMSRINIKLQSNEETEINGKGPKISEDDLNNLFNK
LDKLNEKDFLILSGSIVDTIPQNIYEVIMARLKEKDIKFVVDATKELLLSVLKYKPFLIK
PNHHELGELFNVQLKNQEEVISYGTKLQKMGAENVLISMAGDGAIFISSTGEVMRSTVPR
GILKNSVGAGDSMVAGFIAGYIKNNRLDYAFRMGVATGSASAFSDKLATKVEVEGLLDQV
KIF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgatttatactattgcatttaatccagctttagattatgtaattaaagtggaagattta
aggttgggaaatttaaacagaacagattttgaaggagtttatcctggaggtaaggggatt
aatgtttcaatagttttaaataatttaggaatagaaaatgtagcatttggatatatagct
ggatttactggggttgagatagaaaaaagggttaatgagctaggatgtgcaacggatttt
attaaattagatacgggaatgtcccgaataaatataaaattacaatctaatgaggaaaca
gagataaatgggaagggtcccaagataagtgaagatgatctaaataacttatttaataaa
ttagataagttaaatgaaaaagattttttaatcctatcaggaagtattgtagatactatt
cctcagaatatatatgaagttataatggcaagacttaaggaaaaggatataaaatttgtg
gtagatgctactaaagaattattgttaagtgtactaaaatataaaccatttttaattaag
cctaatcatcatgagttaggagaattatttaatgtacaacttaaaaaccaagaagaagta
atttcctatggtacaaaactacaaaaaatgggtgctgaaaatgtacttatttctatggct
ggagatggggctatatttatttcttctacaggagaagtcatgagaagtactgtgccaaga
ggaatattaaaaaattctgtaggggctggagactctatggtggcaggatttatagcagga
tacataaaaaataataggctagattatgcatttagaatgggagttgcaacaggcagtgca
agtgcattttctgataaattagccacaaaagtagaggttgaaggtttgctagatcaagta
aaaatattttaa

DBGET integrated database retrieval system