KEGG   Clostridium botulinum BKT015925: CbC4_0990Help
Entry
CbC4_0990         CDS       T01475                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CbC4_0990
   00052 Galactose metabolism
    CbC4_0990
   00500 Starch and sucrose metabolism
    CbC4_0990
   00520 Amino sugar and nucleotide sugar metabolism
    CbC4_0990
Enzymes [BR:cbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CbC4_0990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1101119..1102033
Genome map
AA seq 304 aa AA seqDB search
MFGMKVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVASGIEEILIITG
RNKRAIEDHFDKSVELEDILEAKGKEELLNMVSDISNMVDIYYIRQKEPKGLGHAINCAK
TFVGNEPFAVMLGDDVVDSEVPCLKQLINCFNEYKTTIVGVQEVDKNSVDKYGIVEGFHI
EDNVYKVKDLVEKPQINEAPSNVAILGRYIITPPIFDILSKTAPGKSGEIQLTDALRTLI
KQEAMYAYKFEGRRYDVGDKLGFLEATVEFALKRKELRREFMKYLTTIKYNPKFAELYKE
INKK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgtttggtatgaaggtaaaaaaggccataatacctgcagctggacttggaactagattc
ttgccagcaactaaagcacaacccaaggagatgcttcctatagtagataagccaactata
cagtatattatagaagaggcagtagcatcaggcattgaggaaatattgataataactgga
agaaacaaaagggctattgaagatcattttgataagtctgtggaactagaagatattttg
gaagctaagggaaaagaagaacttttaaatatggtaagtgatatatcaaatatggtcgat
atatactacatacgtcaaaaagaacctaaaggtcttggtcatgcaataaattgtgctaag
acatttgtaggaaatgaacctttcgcagttatgctaggtgatgatgtagtagatagtgaa
gttccttgtttaaaacaattaattaattgttttaatgaatataaaacaactatagtaggt
gttcaagaagtagataaaaatagtgtagataaatatggaatagttgaaggatttcacata
gaggataatgtatataaagtaaaagatttagttgaaaaaccacagataaatgaagcgcca
tctaatgtagcaattttaggtagatacataataactccacctatatttgatatattaagt
aaaacagcaccaggtaagtcaggagaaatacaacttacggatgctcttagaactttaata
aaacaagaagctatgtatgcgtataaatttgaaggaagaagatatgatgttggagataaa
cttggatttttagaagctacagtagaatttgctttaaaaagaaaagaattacgacgtgaa
tttatgaaatatttaacaactatcaaatataatcctaaatttgcagaattatataaggaa
ataaacaaaaaatag

DBGET integrated database retrieval system