KEGG   Clostridium botulinum BKT015925: CbC4_1084Help
Entry
CbC4_1084         CDS       T01475                                 

Definition
protein-glutamate methylesterase CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:cbn02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:cbn02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1205416..1206507
Genome map
AA seq 363 aa AA seqDB search
MEKIKVIVVDDSALMRKIISDIINSQNDMEVISTARNGQDLMNKLQKESPDVITLDIEMP
KMDGIETLKAMQKEKLNIPSIMLSSVSKTGTALTMDCLQKGAFDFIPKPSGAISLDIEKV
GEELIKKIRLAKSHSACKSKNDLKNVRPLNTNDDSKKVLTRNVSNMRRSRRSSRIEAVVI
GASTGGPKALYKVITELPEKLNIPIFVVQHMPVGFTKAFAERLDINSKIKVVEATDEEII
QKNVVYVAKGGLHMEVGMDKKIHLVSEPPIWGVRPAVDKLFISSSKLYGPNILSVVLTGM
GKDGADGTRVIKDNGGTTISQDKSTCTIYGMPKAAFETGKVDEVLPIDEIAEAIIKNTIG
MER
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaaaataaaagttatagttgtagatgattcagctttaatgagaaaaatcatctcc
gacattatcaattcacaaaatgacatggaagttatatctactgctagaaatggacaggat
ctaatgaataagcttcagaaagaatccccagatgtaataacattagatatagaaatgcct
aagatggatggtatagaaactttaaaagcaatgcaaaaggaaaagttaaatataccatca
ataatgttaagtagtgtatcaaaaactggaacagctttaactatggattgtttgcaaaag
ggtgcctttgattttattccaaaaccatcaggtgcaatatcattagatattgaaaaagtt
ggtgaggaactcattaaaaaaattagattagccaaaagtcatagtgcttgcaaatctaaa
aatgatttaaaaaatgtaagacctttaaatacaaatgatgatagcaaaaaagttttaact
agaaatgtatcaaatatgagaagaagtagaaggtcatccagaatagaggctgttgttata
ggcgcatcaacagggggacctaaggctttatataaagttataacagaacttccagaaaaa
ttaaatatacctatttttgtagttcaacatatgccagttggatttacaaaagcttttgca
gaaagacttgatattaatagcaaaataaaagttgttgaagctacagatgaagaaataata
caaaaaaatgtagtttatgtagcaaagggaggccttcatatggaggtgggaatggataaa
aagatacatttagtatcagaaccacctatatggggagttagaccggctgtagataaatta
tttatttcatcatcaaaattatatggtcctaatattttaagtgtagttttaactggaatg
ggcaaagatggtgcagatggaacaagggttataaaagataatgggggtacaactatttca
caagacaaatctacttgtacaatatatggtatgcccaaagcagcttttgaaacaggtaaa
gttgatgaagtacttcctattgatgaaattgcagaagctataattaaaaatacaataggc
atggagaggtaa

DBGET integrated database retrieval system