KEGG   Clostridium botulinum BKT015925: CbC4_1285Help
Entry
CbC4_1285         CDS       T01475                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CbC4_1285
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CbC4_1285
   00052 Galactose metabolism
    CbC4_1285
   00500 Starch and sucrose metabolism
    CbC4_1285
   00520 Amino sugar and nucleotide sugar metabolism
    CbC4_1285
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CbC4_1285
   00524 Butirosin and neomycin biosynthesis
    CbC4_1285
Enzymes [BR:cbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CbC4_1285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1372728..1373696
Genome map
AA seq 322 aa AA seqDB search
MRIGIDLGGTNIAAGLVDNNGVLVNKASIKTNLNDNGKFIIDDMVSLVNKLLDENNLDIN
DLNSIGIGVPGTVRYEKGIVAECVNLGWKEVPLAENINSKIKAIFNTEKDVKILIENDAN
AAALGEHLVGSMQDCNSALLITLGTGVGGGLVLNGKVHRGKDGAALEIGHMIIGENFYNC
SCGNNGCFETFASATAIIKYAQELIKDGEKSIINDKVNGDLDKIDAKIVFDSAREGDKVG
NLTLDRFIKYLATGINNLINVLDLDVIAIGGGVVAGSDLFMDKLIQYIKDHKLFKALDLC
KIEKAQLGNDAGIIGAAMLDRI
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagaataggcattgatttgggtggaaccaatatagctgcaggattagtagataataat
ggggttttagttaacaaagctagtataaaaactaatctaaatgacaatggtaaatttata
atagatgatatggtatctttagtaaacaaattattagatgaaaataatttagatataaat
gatttaaattcgataggaattggagtacctggaactgtaagatatgaaaaaggaatagtt
gctgaatgtgtaaatcttggatggaaagaagttcctttagctgaaaatattaattctaaa
attaaagcaatattcaatactgaaaaagatgttaaaatactaattgaaaacgatgctaat
gctgctgcactaggagaacatttagttggaagcatgcaagattgtaatagtgccctttta
ataacactaggaactggtgttggtggtggtttggttttaaatggcaaagtacatagggga
aaagatggagctgcattagaaataggacatatgattatcggagaaaatttctataattgt
tcttgtggtaataatggatgctttgaaacttttgcttcagctacagctataataaaatat
gctcaagaattaattaaagatggtgaaaaaagtataataaatgataaagttaacggcgat
ttagataaaattgatgcaaagatagtatttgattccgcaagagaaggcgacaaggttgga
aaccttactctagatagatttataaaatatctagcaactggtatcaataacttaataaat
gtattagatttagatgttattgcaattggtgggggagtagtagctggttcagatttattt
atggacaaactaatacaatatataaaagaccataagctatttaaagcactagacctttgc
aaaatagaaaaagcacaactaggaaatgatgctggtattatcggtgcagctatgttagat
agaatttaa

DBGET integrated database retrieval system