KEGG   Clostridium botulinum BKT015925: CbC4_1726Help
Entry
CbC4_1726         CDS       T01475                                 

Definition
acetaldehyde dehydrogenase
Orthology
K00132  
acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    CbC4_1726
   00650 Butanoate metabolism
    CbC4_1726
Enzymes [BR:cbn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     CbC4_1726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1841614..1843245)
Genome map
AA seq 543 aa AA seqDB search
MGNIDKDLCSIQQARDLARLGKIAADKIANYTEEQIDKILRNMVRVAEENAGYLAEMAVK
ETGFGKVFDKAYKNHLASTVVYNSIKDMKTIGIIEKDKKNKIIKIAEPVGLILGIVPSTN
PTSTAIFKAIISIKSRNAIVFSPHPSAKKCTVKALELMRDAAIEAGAPENIINCITTPTL
EATNELMKCKEVSMIIATGGPGMVKAAYSSGKPALGVGAGNSPAYIERTANVEKAVRDII
SSKTFDNGTICASEQSIICEECNLDKVVEEFKKQGGYFMTEEETLKVCRLLFKNGHTMNA
KFVGRSPQVIASAAGFIVPEETKLLIGKQNGVGEGNPLSFEKLTTVLAFYTVKDWQEACE
LSIELLQNGIGHTMSLHTEDDDIVMKFARKPASRILVNTGGSQGGTGATTGLSPAFTLGC
GTWGGSSTSENVTPEHLINIKRVAYGLKDCTTLVEDDKTFNYIKKNRYGNTECCNEVEKQ
FMDMSPAQIKAASEWLNNNNCTKDVNKCTENANVYTENNNEGTKNQELLELVNQIVAAMK
GAN
NT seq 1632 nt NT seq  +upstreamnt  +downstreamnt
atggggaatattgacaaggatttgtgttcaatacaacaagcaagggatcttgctagactt
ggaaaaatagcagcagataaaattgctaattatactgaagaacaaattgataaaattttg
cgcaatatggttagagttgcagaagaaaatgctggttatttagcagaaatggcagttaaa
gaaactggttttggaaaagtttttgataaagcttataaaaaccatttagcatctactgta
gtatataactcaattaaagatatgaaaactataggaataattgaaaaagacaaaaaaaat
aaaattataaaaattgccgaaccagttgggttaattcttggaatagtaccttcaacaaat
ccaacatctactgcaatttttaaggctattatttcaattaaatctcgtaatgctatagta
ttttcaccacatccatctgctaaaaagtgtacagttaaagcacttgaattaatgagagat
gcagcaatagaagctggtgcaccagaaaatataataaattgtataactacaccaacactt
gaagctacaaatgaattaatgaaatgcaaagaggtttctatgataatagcaacaggtggt
ccaggcatggttaaagcagcttacagttcaggaaaacctgctcttggggttggtgcagga
aattcaccagcatatattgaaagaactgccaatgtagaaaaagctgttagagatattatt
tcaagtaagacttttgataatggtacaatctgcgcttcggagcaatcaataatttgtgaa
gaatgtaaccttgataaggttgttgaagagtttaaaaaacaaggtggatattttatgaca
gaagaagaaactcttaaagtttgtagactgctattcaaaaatggacataccatgaatgct
aagtttgttggaagaagtccacaggttattgcaagtgcagctggttttatagttccagaa
gaaactaaattacttataggaaagcaaaatggtgtaggagaaggaaatccactatctttt
gaaaaacttacaacggttcttgcattttacacagtaaaagattggcaggaagcatgcgaa
ttaagcattgaattacttcaaaacggaattggtcacacaatgagtcttcatactgaagat
gatgatatagttatgaagtttgctagaaagccagcctctcgtattcttgttaatactggt
ggttctcaaggaggaacaggtgcaactacaggccttagtcctgcattcactttaggttgt
ggtacatggggtggaagttcaacttctgaaaatgttacaccagagcatcttataaacatt
aaaagagttgcctatggactaaaagattgtacaacacttgtagaggatgataaaactttt
aattacatcaaaaaaaatcgatatggtaatactgaatgttgtaatgaagttgaaaagcaa
tttatggatatgagtccagctcaaattaaggcagcatctgaatggctaaataataataat
tgtactaaagatgttaataaatgcactgaaaatgctaatgtttatactgaaaataataat
gaagggacaaaaaaccaagaacttttagagttagttaatcaaatagtagccgctatgaaa
ggggcaaactag

DBGET integrated database retrieval system