KEGG   Clostridium botulinum BKT015925: CbC4_2010Help
Entry
CbC4_2010         CDS       T01475                                 

Gene name
hemB
Definition
porphobilinogen synthase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cbn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2160402..2161373)
Genome map
AA seq 323 aa AA seqDB search
MNIVKRPRRLRVNRVIRDLVRETTLNMNDFIYPLFVVEGENIKKEISSLKGQYQFSIDKL
EEEIKELVSLGIKSVILFGIPDVKDEVGCGAYDDNGIIQRAVREIKGKFKDMYVVTDLCM
CEYTSHGHCGILDEDGYVNNDKTLKYLAKIAVSQAKAGANMIAPSDMMDGRIAAIREALD
KEGFCNIPIMSYSAKYASAFYGPFRDAADSAPSFGDRKSYQMDPANVNEGIRETELDIEE
GADIVMVKPALPYLDVLRKVKDTFNIPVAAYNVSGEYAMIKNAVDAGLLDESAILESLIS
IKRAGADIIITYFAKDAARMLRR
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgtaaaaagacctagacgtttaagagttaatagagtaataagagatttagtt
agagaaacaactttaaatatgaatgattttatatatcctttatttgtagttgaaggagaa
aatataaaaaaagaaatttcatcattaaaaggacaatatcaattttccatagataaacta
gaagaagaaataaaagaacttgtatcattaggtataaaatctgtaatattatttggaatt
ccagatgtaaaagatgaagtgggttgtggtgcatatgatgataatggaataattcaaaga
gcggtcagagaaataaaaggtaaatttaaagatatgtatgttgtaactgacctttgtatg
tgtgaatatacatctcatggacattgtggaattttagatgaagatggatatgtaaataat
gataaaacgctaaaatatttagctaaaattgcagtaagccaagcaaaagcaggagcaaat
atgatagcaccttcagatatgatggatggaagaatagctgcaataagagaagctttagac
aaagaaggattttgtaatatacctataatgtcatatagtgcaaaatatgcatcagctttt
tatggaccatttagagatgcagcggattcagctccatcttttggtgatagaaaatcatat
caaatggatccggccaatgttaatgaaggcataagagagactgagcttgatatagaagaa
ggcgcagatatagtaatggtaaagcctgcacttccttatttagatgttttaagaaaagtt
aaagatacatttaacatacctgtagctgcttataatgttagtggagaatatgcaatgata
aaaaatgctgtagatgcgggacttttagatgaaagtgccattttagaatcattaatttcc
ataaagagagcaggggcagatataataataacttattttgctaaagatgcagcaagaatg
cttaggaggtag

DBGET integrated database retrieval system