KEGG   Clostridium botulinum BKT015925: CbC4_2011Help
Entry
CbC4_2011         CDS       T01475                                 

Definition
(GenBank) uroporphyrinogen III synthase/methyltransferase
  KO
K13542  uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
cbn00860  Porphyrin and chlorophyll metabolism
cbn01100  Metabolic pathways
cbn01110  Biosynthesis of secondary metabolites
cbn01120  Microbial metabolism in diverse environments
Module
cbn_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CbC4_2011
Enzymes [BR:cbn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CbC4_2011
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CbC4_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 TP_methylase
Motif
Other DBs
NCBI-ProteinID: AEB76680
Position
complement(2161426..2162922)
Genome map
AA seq 498 aa AA seqDB search
MNGKVFLVGAGPGDYKLITLKGMECIKKSDVIVYDRLASSRLLKEAKETCEFIYVGKKSS
NHTKTQDEINDIIVHKAKTGKIVTRLKGGDPYVFGRGGEEGEYLNKKGVKFEVIPGITSA
IGGLCYAGIPITHRDYASSFHVITGHLKEEGAELNWKSISSLEGTLVFLMGVSNLKNICN
SLIKEGKNKFTKAAIINWASTTKQKVVVGNLENIYEKAMAEKISSPSLIVIGEVVSLRDK
LNFFENKPLFGKNIVVTRSRVQSSNLVERIIELGGNPIEVPAIKIEEIPSNVELDNGIEY
INEFNYLIFTSRNAVKIFFERLFELNFDSRKLGNLKVVAIGTGTSDELRHYGIIPDVLPK
KFVAESVVELLKEVLQKEDKVFIPRSSEARTYLVEELNKLCNVTEVKIYNTIKGSGNKDD
IINLLNNKNIDYITFTSSSTVKNFIEIMGKQNIEKLKDTKLVSIGPITSKTIEDFGLKVY
NEAEEYTIEGIIKTLIRG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaaagtatttttagtaggagcaggtccgggagattacaaacttataacttta
aaaggtatggaatgtataaaaaaatcagatgtaattgtttatgatagattagcaagtagt
aggcttttgaaagaggctaaagaaacttgtgaatttatttatgttggaaaaaagtctagt
aatcatactaaaactcaagatgaaatcaatgatattatagtacataaagctaaaacggga
aaaatagttacaagattgaagggtggagatccctatgtttttggtagaggtggagaagaa
ggagaatatttaaataaaaaaggtgtgaaatttgaggttatacctggaataacatcagct
ataggtgggctttgctatgcaggtataccaattacacatagagattatgcatcatctttt
catgttataacaggtcatttaaaagaagaaggagcagaacttaattggaagtcaatatct
tcattagaaggaactttagtatttttaatgggagtttctaatttaaaaaatatatgcaat
tctttaattaaagaaggaaaaaataaatttactaaagctgctataataaattgggcaagt
actacaaaacaaaaagttgtagttggaaatttagaaaatatatatgaaaaagctatggct
gaaaagataagttcaccaagtcttattgtaataggtgaggttgtatcacttagggataaa
ttaaatttctttgagaataaaccattgtttgggaaaaatatagttgtaactagatcacgt
gttcaaagtagtaaccttgtggaaagaataattgaacttggaggaaatcctatagaagtt
cctgcaattaagatagaagaaatacctagtaatgtggaacttgataatggaatagaatat
atcaatgaatttaactatttaattttcactagtagaaatgctgttaaaatattttttgaa
agattgtttgaacttaattttgatagtagaaagttaggtaacttgaaagttgtagctata
ggaacaggaacatcagatgaacttagacattatggaattattccagatgttttaccaaaa
aaatttgtagctgaatctgtagtagaattactaaaagaagttctacaaaaagaggataaa
gtttttataccaagatcaagtgaagctagaacatatttagtagaagaattaaataaactt
tgtaatgttacagaagtcaaaatttataatactataaaaggttcaggcaataaagatgat
ataattaatttattaaacaacaaaaatatagattatataacatttacaagttcatctaca
gtaaaaaattttattgaaataatgggaaaacaaaatatagaaaaattaaaggatacaaaa
ttagtttcaataggacctataacttcaaagactatagaagattttggccttaaggtttat
aatgaagcagaagaatatacaatagaaggaattattaaaactttaataagaggatag

DBGET integrated database retrieval system