KEGG   Clostridium botulinum BKT015925: CbC4_2011Help
Entry
CbC4_2011         CDS       T01475                                 

Definition
uroporphyrinogen III synthase/methyltransferase (EC:2.1.1.107)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    CbC4_2011
Enzymes [BR:cbn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     CbC4_2011
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     CbC4_2011
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2161426..2162922)
Genome map
AA seq 498 aa AA seqDB search
MNGKVFLVGAGPGDYKLITLKGMECIKKSDVIVYDRLASSRLLKEAKETCEFIYVGKKSS
NHTKTQDEINDIIVHKAKTGKIVTRLKGGDPYVFGRGGEEGEYLNKKGVKFEVIPGITSA
IGGLCYAGIPITHRDYASSFHVITGHLKEEGAELNWKSISSLEGTLVFLMGVSNLKNICN
SLIKEGKNKFTKAAIINWASTTKQKVVVGNLENIYEKAMAEKISSPSLIVIGEVVSLRDK
LNFFENKPLFGKNIVVTRSRVQSSNLVERIIELGGNPIEVPAIKIEEIPSNVELDNGIEY
INEFNYLIFTSRNAVKIFFERLFELNFDSRKLGNLKVVAIGTGTSDELRHYGIIPDVLPK
KFVAESVVELLKEVLQKEDKVFIPRSSEARTYLVEELNKLCNVTEVKIYNTIKGSGNKDD
IINLLNNKNIDYITFTSSSTVKNFIEIMGKQNIEKLKDTKLVSIGPITSKTIEDFGLKVY
NEAEEYTIEGIIKTLIRG
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgaatggaaaagtatttttagtaggagcaggtccgggagattacaaacttataacttta
aaaggtatggaatgtataaaaaaatcagatgtaattgtttatgatagattagcaagtagt
aggcttttgaaagaggctaaagaaacttgtgaatttatttatgttggaaaaaagtctagt
aatcatactaaaactcaagatgaaatcaatgatattatagtacataaagctaaaacggga
aaaatagttacaagattgaagggtggagatccctatgtttttggtagaggtggagaagaa
ggagaatatttaaataaaaaaggtgtgaaatttgaggttatacctggaataacatcagct
ataggtgggctttgctatgcaggtataccaattacacatagagattatgcatcatctttt
catgttataacaggtcatttaaaagaagaaggagcagaacttaattggaagtcaatatct
tcattagaaggaactttagtatttttaatgggagtttctaatttaaaaaatatatgcaat
tctttaattaaagaaggaaaaaataaatttactaaagctgctataataaattgggcaagt
actacaaaacaaaaagttgtagttggaaatttagaaaatatatatgaaaaagctatggct
gaaaagataagttcaccaagtcttattgtaataggtgaggttgtatcacttagggataaa
ttaaatttctttgagaataaaccattgtttgggaaaaatatagttgtaactagatcacgt
gttcaaagtagtaaccttgtggaaagaataattgaacttggaggaaatcctatagaagtt
cctgcaattaagatagaagaaatacctagtaatgtggaacttgataatggaatagaatat
atcaatgaatttaactatttaattttcactagtagaaatgctgttaaaatattttttgaa
agattgtttgaacttaattttgatagtagaaagttaggtaacttgaaagttgtagctata
ggaacaggaacatcagatgaacttagacattatggaattattccagatgttttaccaaaa
aaatttgtagctgaatctgtagtagaattactaaaagaagttctacaaaaagaggataaa
gtttttataccaagatcaagtgaagctagaacatatttagtagaagaattaaataaactt
tgtaatgttacagaagtcaaaatttataatactataaaaggttcaggcaataaagatgat
ataattaatttattaaacaacaaaaatatagattatataacatttacaagttcatctaca
gtaaaaaattttattgaaataatgggaaaacaaaatatagaaaaattaaaggatacaaaa
ttagtttcaataggacctataacttcaaagactatagaagattttggccttaaggtttat
aatgaagcagaagaatatacaatagaaggaattattaaaactttaataagaggatag

DBGET integrated database retrieval system