KEGG   Clostridium botulinum BKT015925: CbC4_2447Help
Entry
CbC4_2447         CDS       T01475                                 

Gene name
glgC
Definition
glucose-1-phosphate adenylyltransferase (EC:2.7.7.27)
Orthology
K00975  
glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cbn00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:cbn00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2653792..2654940
Genome map
AA seq 382 aa AA seqDB search
MIKKEMLAMILAGGQGTRLKILTKNNAKPAVPFGGKYRIIDFTLSNCSNSGIDTIGVLTQ
YEPHILNSHIGIGSPWDLDRNRGGVSILPPHMRNDGGNWYMGTADAIYQNIMFIDKYDPE
YLLVLSGDHIYKMDYSKMLKFHKEKNSDATIAVIDVPLEEASRFGIMNTEDDNKIYEFDE
KPENPKSNKASMGIYIFNWKILKEFLIEDSELEDSDHDFGKNIIPNLLSSGYNLYAYSFN
GYWKDVGTIESLWQANMDLLNPENTLDIYNRDWKIYSVSPTKPPQYTGPNAIIQNSLVVE
GCAVFGKVQNSVLFPEVEIGKNSIIEDSVVMSNVKIGENAIIRKCIIGSHTIIEKNSVIG
NSDDITVIGDGEKIKTNSIIKN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagaaatgctagccatgattcttgcaggtggacaaggtacacgacttaaa
attctaactaaaaataatgcaaaacctgctgtaccttttggaggtaaatatagaattata
gattttaccttaagtaattgttccaactctggaatcgacaccattggagtattgacacaa
tatgaaccgcatatacttaattctcatataggtataggtagcccttgggatttggataga
aatcgaggtggagtttcaattcttccaccccacatgagaaatgatggtggcaactggtat
atgggtaccgctgatgccatatatcaaaacataatgtttattgataaatatgaccctgaa
tatttactagtactttcaggggatcacatttataaaatggattattcaaaaatgctaaaa
ttccataaagaaaaaaattcggatgccacaatagccgttatagatgttcccctagaagaa
gccagccgttttggaataatgaatactgaagatgataataaaatatatgaatttgatgaa
aaaccagagaatcctaaaagtaataaggcctctatgggaatatatatttttaattggaaa
attctcaaagaatttttaatagaagattcggagcttgaagattccgatcatgatttcggt
aaaaacataattcctaatctattaagttcaggatataatctttatgcttattcctttaat
ggttattggaaagatgttggtaccattgaaagcttatggcaagccaatatggacttatta
aatccagaaaacacattagatatatacaacagagattggaaaatctattctgtaagtcca
actaagcctcctcaatatacaggtccaaatgcaataatccaaaattccctcgtagttgaa
ggatgtgccgttttcggtaaggttcaaaattctgtactattccctgaagttgaaataggt
aaaaatagtataattgaagattccgtagtaatgtctaatgtaaagataggtgaaaatgca
ataataagaaaatgtataattggaagtcatacaatcatagaaaaaaatagtgttatagga
aattcagatgatataactgttattggtgatggagaaaaaattaaaactaactccataatt
aagaattag

DBGET integrated database retrieval system