KEGG   Clostridium botulinum BKT015925: CbC4_2447Help
Entry
CbC4_2447         CDS       T01475                                 

Gene name
glgC
Definition
glucose-1-phosphate adenylyltransferase (EC:2.7.7.27)
Orthology
K00975  
glucose-1-phosphate adenylyltransferase [EC:2.7.7.27]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CbC4_2447 (glgC)
   00520 Amino sugar and nucleotide sugar metabolism
    CbC4_2447 (glgC)
Enzymes [BR:cbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.27  glucose-1-phosphate adenylyltransferase
     CbC4_2447 (glgC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2653792..2654940
Genome map
AA seq 382 aa AA seqDB search
MIKKEMLAMILAGGQGTRLKILTKNNAKPAVPFGGKYRIIDFTLSNCSNSGIDTIGVLTQ
YEPHILNSHIGIGSPWDLDRNRGGVSILPPHMRNDGGNWYMGTADAIYQNIMFIDKYDPE
YLLVLSGDHIYKMDYSKMLKFHKEKNSDATIAVIDVPLEEASRFGIMNTEDDNKIYEFDE
KPENPKSNKASMGIYIFNWKILKEFLIEDSELEDSDHDFGKNIIPNLLSSGYNLYAYSFN
GYWKDVGTIESLWQANMDLLNPENTLDIYNRDWKIYSVSPTKPPQYTGPNAIIQNSLVVE
GCAVFGKVQNSVLFPEVEIGKNSIIEDSVVMSNVKIGENAIIRKCIIGSHTIIEKNSVIG
NSDDITVIGDGEKIKTNSIIKN
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgataaaaaaagaaatgctagccatgattcttgcaggtggacaaggtacacgacttaaa
attctaactaaaaataatgcaaaacctgctgtaccttttggaggtaaatatagaattata
gattttaccttaagtaattgttccaactctggaatcgacaccattggagtattgacacaa
tatgaaccgcatatacttaattctcatataggtataggtagcccttgggatttggataga
aatcgaggtggagtttcaattcttccaccccacatgagaaatgatggtggcaactggtat
atgggtaccgctgatgccatatatcaaaacataatgtttattgataaatatgaccctgaa
tatttactagtactttcaggggatcacatttataaaatggattattcaaaaatgctaaaa
ttccataaagaaaaaaattcggatgccacaatagccgttatagatgttcccctagaagaa
gccagccgttttggaataatgaatactgaagatgataataaaatatatgaatttgatgaa
aaaccagagaatcctaaaagtaataaggcctctatgggaatatatatttttaattggaaa
attctcaaagaatttttaatagaagattcggagcttgaagattccgatcatgatttcggt
aaaaacataattcctaatctattaagttcaggatataatctttatgcttattcctttaat
ggttattggaaagatgttggtaccattgaaagcttatggcaagccaatatggacttatta
aatccagaaaacacattagatatatacaacagagattggaaaatctattctgtaagtcca
actaagcctcctcaatatacaggtccaaatgcaataatccaaaattccctcgtagttgaa
ggatgtgccgttttcggtaaggttcaaaattctgtactattccctgaagttgaaataggt
aaaaatagtataattgaagattccgtagtaatgtctaatgtaaagataggtgaaaatgca
ataataagaaaatgtataattggaagtcatacaatcatagaaaaaaatagtgttatagga
aattcagatgatataactgttattggtgatggagaaaaaattaaaactaactccataatt
aagaattag

  All links  
No link information was found.   
DBGET integrated database retrieval system