KEGG   Clostridium botulinum BKT015925: CbC4_2502Help
Entry
CbC4_2502         CDS       T01475                                 

Gene name
celM
Definition
(GenBank) endoglucanase, aminopeptidase M42 family
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2715583..2716566)
Genome map
AA seq 327 aa AA seqDB search
MDRLMESLIDSFGVSTREENIKDIIKKQINLINEEKLLNLDLNEDDMGNIVVKLGEGTEK
LMISTHIDNSGLMITDIDDNGFFKVVPMGSIDLKNISANFFKSQDGHIGRMGFLKEGSSE
DNLFIDFGLSTKENAKDKIKEGDTLELIGHKIEVENKIIGANIHSRIACYILLKVIENIN
IKNLNKELYFVFSVQKELGCKGARLAAVNIKPNSAIVLEAMDSDDTKEGSSKIALDKGTI
MSVFDRSLVIHHKVKETIEEISKKLNLKLQYSISDGQNEGGFIHKEVGGIKTGMIAIPCR
YINTSGEMISLKDVENTISLLNGVIDI
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atggatagattaatggaaagtttaatagattcatttggggttagtacaagagaagagaat
attaaagatattataaaaaaacaaattaatttaatcaatgaagaaaaattattgaattta
gatttaaatgaagatgatatgggaaatatagttgttaaacttggagaaggcacagaaaaa
ttaatgatatctactcatatagataattctggacttatgataacggatatagatgataat
ggattttttaaagttgttcctatgggaagtatagatttaaaaaatatttcagcaaacttt
tttaaatctcaagatggacatataggaagaatgggatttttaaaagagggatcatcagaa
gataatttatttattgattttggactatctactaaagaaaatgctaaagataaaattaaa
gagggagatacccttgaacttataggccacaaaatagaagttgaaaataaaataattggt
gcaaatattcatagtagaatagcgtgttatatacttcttaaagttatagagaatataaat
ataaaaaatttaaataaagaattgtattttgtattttcagtacaaaaagaattaggatgt
aaaggtgcaaggctagcagcagttaatataaaaccaaatagtgctatagttttagaggcc
atggattctgatgatactaaagaaggttcatctaaaatagctttagataaaggtactatt
atgtctgtatttgatagaagtcttgtaattcatcataaagttaaagagacaattgaggaa
atttctaaaaaattaaatttaaaacttcaatatagtataagtgatggacaaaatgaaggt
ggttttatacataaagaagttggaggaataaaaacaggaatgatagcaattccatgtaga
tatattaatacatctggtgaaatgatatctttaaaagatgttgaaaatacaattagttta
ttaaatggagttattgacatttaa

DBGET integrated database retrieval system