KEGG   Clostridium botulinum BKT015925: CbC4_2504Help
Entry
CbC4_2504         CDS       T01475                                 

Definition
aminopeptidase M42 family endoglucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    CbC4_2504
Enzymes [BR:cbn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     CbC4_2504
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2716877..2717851)
Genome map
AA seq 324 aa AA seqDB search
MLLEKLCNAVAPSSYEDEVRNIIKDSIKDFVNEVNIDKMGNIIAHKKGSGKTVVLDAFMD
EIGFIITAYNNDGTLKFTSLGNVQEESIPCKAVNIGKNKISGVIGLKAIHLQNKKEREES
IDIETLSIDIGATSKEEAKKYVSIGDEVSFTTEFELLGEKYIKGKALESRIPCYVLIELL
KENYNADIYAIFTTQRQIGSRGAIISSYNIKSDITLVLEGALTKEQQNKIGKGPSISRID
NNTICHNSLIDDMKTIGEKEKIPYQIKKYINNENDGDSYISTGNTKKLLTISIPCKYMKS
PISVSSKEDIENTIKLIRGYLKSL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcttctagaaaaactttgtaatgcagtggcaccttcatcttatgaagatgaagtaaga
aatataataaaagactcaattaaagattttgttaatgaagtaaatatagataaaatggga
aatataattgcacataaaaaaggatctgggaaaacagtagtattagatgcttttatggat
gagatcggatttattattactgcatataacaatgatggtactttaaaattcacatcactt
ggaaacgtacaagaagaaagtattccatgtaaggctgttaatataggaaaaaataaaatt
agtggtgtcataggattaaaagccatacatctacaaaataaaaaagaaagagaagaaagt
atagatatagaaacattgtctatagatattggagctacatctaaagaagaggctaaaaag
tatgtatctataggagatgaagtttcatttaccacggaatttgaacttttaggtgaaaaa
tatattaagggaaaagcattagaaagtaggattccctgttatgtattaatagaactttta
aaagaaaactataatgctgatatttatgctatatttacaactcaaaggcagataggaagt
agaggagctattatatcatcatataatataaaatcagatattacccttgtacttgaagga
gcattaactaaggaacaacaaaataaaataggaaagggaccatcaatatcaagaatagat
aataatactatttgtcataatagccttattgatgatatgaaaacaattggagaaaaagaa
aaaataccatatcaaataaaaaaatatataaataacgaaaatgatggtgattcatatata
agcacagggaacactaaaaaacttcttacaatatctataccttgtaaatatatgaagtca
cctatttcagtttcttctaaagaagatattgaaaataccataaagttaattaggggatat
ttaaaatctttatag

DBGET integrated database retrieval system