KEGG   Clostridium botulinum BKT015925: CbC4_2504Help
Entry
CbC4_2504         CDS       T01475                                 

Definition
(GenBank) endoglucanase, aminopeptidase M42 family
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2716877..2717851)
Genome map
AA seq 324 aa AA seqDB search
MLLEKLCNAVAPSSYEDEVRNIIKDSIKDFVNEVNIDKMGNIIAHKKGSGKTVVLDAFMD
EIGFIITAYNNDGTLKFTSLGNVQEESIPCKAVNIGKNKISGVIGLKAIHLQNKKEREES
IDIETLSIDIGATSKEEAKKYVSIGDEVSFTTEFELLGEKYIKGKALESRIPCYVLIELL
KENYNADIYAIFTTQRQIGSRGAIISSYNIKSDITLVLEGALTKEQQNKIGKGPSISRID
NNTICHNSLIDDMKTIGEKEKIPYQIKKYINNENDGDSYISTGNTKKLLTISIPCKYMKS
PISVSSKEDIENTIKLIRGYLKSL
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgcttctagaaaaactttgtaatgcagtggcaccttcatcttatgaagatgaagtaaga
aatataataaaagactcaattaaagattttgttaatgaagtaaatatagataaaatggga
aatataattgcacataaaaaaggatctgggaaaacagtagtattagatgcttttatggat
gagatcggatttattattactgcatataacaatgatggtactttaaaattcacatcactt
ggaaacgtacaagaagaaagtattccatgtaaggctgttaatataggaaaaaataaaatt
agtggtgtcataggattaaaagccatacatctacaaaataaaaaagaaagagaagaaagt
atagatatagaaacattgtctatagatattggagctacatctaaagaagaggctaaaaag
tatgtatctataggagatgaagtttcatttaccacggaatttgaacttttaggtgaaaaa
tatattaagggaaaagcattagaaagtaggattccctgttatgtattaatagaactttta
aaagaaaactataatgctgatatttatgctatatttacaactcaaaggcagataggaagt
agaggagctattatatcatcatataatataaaatcagatattacccttgtacttgaagga
gcattaactaaggaacaacaaaataaaataggaaagggaccatcaatatcaagaatagat
aataatactatttgtcataatagccttattgatgatatgaaaacaattggagaaaaagaa
aaaataccatatcaaataaaaaaatatataaataacgaaaatgatggtgattcatatata
agcacagggaacactaaaaaacttcttacaatatctataccttgtaaatatatgaagtca
cctatttcagtttcttctaaagaagatattgaaaataccataaagttaattaggggatat
ttaaaatctttatag

DBGET integrated database retrieval system