KEGG   Clostridium botulinum BKT015925: CbC4_2505Help
Entry
CbC4_2505         CDS       T01475                                 

Definition
(GenBank) Peptidase family M20/M25/M40 protein
Organism
cbn  Clostridium botulinum BKT015925
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
Position
complement(2717842..2718861)
Genome map
AA seq 339 aa AA seqDB search
MENKELLKALSLAHAPSSREDKLYTLIKEKFSVFGEVTIDSMNNIIIHKEGNSRGKVMVM
AHADEIFLLVTEILNNGVLKFKGVGVDPKSLVAQEVVIHGTKDILGIVNIGKGINKAVNS
NDLIIDTGYNKESLEKIIKIGDFITIKGKFVELLNSNVACKTIDNRGSIVAMYQCAKELQ
NIQHDLDVYFVCSCQEEVGHRGAKMATYNLNPDIGIAIDTTFDSGELGAKDRENIIGNGP
VICHGPNLHHKLNKKITSIGDKYGIPYGIEVEPGNTGTDAWDIQVSRKGVPSMLVSIPIK
HMHTPVELVNMNDIKNTGKIIARFIENLKENELEELLCF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atggaaaataaagaattattaaaagcgttatccttagcacatgcaccaagtagcagagaa
gataaattatatactttaataaaagagaagttcagtgtatttggagaagttacaattgat
tcaatgaataacattataatacataaagagggcaatagtaggggaaaagtaatggtcatg
gctcatgctgatgagatatttttacttgtaacagaaatattgaataatggagttcttaag
ttcaaaggtgttggagttgatcctaaatctttagtagcacaagaagtagttattcatggt
acaaaagatattttaggaattgtaaatataggtaagggtataaacaaggcagttaattca
aatgatcttataattgatacgggatataataaagaaagtttagaaaaaataattaaaata
ggagatttcattactataaaaggtaaatttgtagaacttctaaatagtaatgttgcttgt
aagactatagataatagaggtagtatagttgctatgtatcagtgcgcaaaagaattacaa
aatattcagcatgatttagatgtatattttgtttgctcttgccaagaagaagttggtcat
agaggagctaaaatggctacttataatttaaatccagacataggaatagcaatagataca
acctttgatagtggagaattaggagcaaaagatagagaaaatattataggaaatggacct
gttatatgtcatggacctaatttacaccataaattaaataaaaaaatcacctctataggt
gataaatatggtataccttatggaattgaagttgaacctggaaatacaggaacagatgct
tgggatatacaagtttcaagaaaaggagtaccaagtatgttagtgtcaattcctataaaa
catatgcatacacctgtggaattggttaatatgaatgatataaaaaatactggcaaaatt
attgcgagatttatagaaaatttaaaagaaaatgagttggaggaattattatgcttctag

DBGET integrated database retrieval system