KEGG   Clostridium botulinum BKT015925: CbC4_4053Help
Entry
CbC4_4053         CDS       T01475                                 

Definition
putative guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
cbn  Clostridium botulinum BKT015925
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:cbn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    CbC4_4053
Enzymes [BR:cbn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     CbC4_4053
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
p1BKT015925:50436..51014
Genome map
AA seq 192 aa AA seqDB search
MNKPKIILVLGQSASGKSTIIEEMEWYGYKAIQSYTTRPKRTKDEKGHIFVREKDYTFIR
DDKTNEIKVYDKLGNEVDTVAYTYFNGNHYWANMDQVEESTYYIIDKAGVDYFANKVESR
VDYKIVYVTVPFLTRIKRLIKRDGLVKGISRLINDFKMFRGLKYDTKIVNRDLEQSVQEL
REITEEFIKEKM
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaccaaaaataattttagtcttaggacaatctgcaagtggtaaatcaactata
atagaagaaatggaatggtatggatataaagctatacaaagttatactactagacctaaa
agaacaaaggatgaaaaaggacatatatttgttagagaaaaagattacacatttattaga
gatgacaaaaccaatgaaataaaagtatatgacaaattagggaacgaagttgatactgta
gcttatacatattttaatggtaatcattattgggcaaacatggatcaagtggaggaaagt
acatattacatcatagataaggcaggagtagattatttcgctaataaagtagaaagcaga
gtagattacaaaatcgtatatgttacagttccattcttgactagaattaaaagattaatc
aaacgagatggattagtaaaagggatatcaagattgattaatgattttaagatgttcaga
ggattaaaatatgatacaaagatagttaatagagacttagaacagagtgttcaggagtta
agagaaataacagaagaatttataaaggaaaaaatgtaa

DBGET integrated database retrieval system