KEGG   Clostridium botulinum A ATCC 3502: CBO0228Help
Entry
CBO0228           CDS       T00533                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBO0228 (tpiA)
   01230 Biosynthesis of amino acids
    CBO0228 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBO0228 (tpiA)
   00051 Fructose and mannose metabolism
    CBO0228 (tpiA)
   00562 Inositol phosphate metabolism
    CBO0228 (tpiA)
Enzymes [BR:cbo01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     CBO0228 (tpiA)
Exosome [BR:cbo04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   CBO0228 (tpiA)
  Exosomal proteins of bladder cancer cells
   CBO0228 (tpiA)
  Exosomal proteins of melanoma cells
   CBO0228 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
269740..270486
Genome map
AA seq 248 aa AA seqDB search
MRTAIIAGNWKMNKTVKEAVELVKELKPLVKDAKCDVVVCPTYVCLPAVLEEVKGSNIKV
GAQNMHFEESGAYTGEIAPKMLEELGVHYVIIGHSERRQYFNETDETVNKKVKKAFEHNL
IPIVCCGESLEEREGNITEKVLEGQIKVGLKELSKEQVEKLVIAYEPIWAIGTGKTATDE
QANETIGYIRTVVKAMYGESVADKVRIQYGGSVKPGTIKAQMAKEEIDGALVGGASLKAE
DFAAIVNY
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgagaacagctataatagcaggaaactggaagatgaacaaaactgtaaaagaagcagta
gaattggttaaagaattaaaaccacttgttaaagatgcaaaatgtgatgtagttgtatgt
cctacttatgtatgccttccagcggtattagaagaagttaaaggaagcaatataaaagta
ggtgctcaaaatatgcactttgaagaaagtggagcttacacaggtgaaatagcacctaaa
atgttagaagaactaggagttcattatgtaattataggacatagtgaaagaagacaatac
tttaatgaaacagatgaaactgtaaataaaaaagtaaaaaaagccttcgaacataactta
attccaatagtttgttgtggagaaagcttagaagaaagagaaggaaatataacagaaaaa
gttttagaaggacaaataaaagttggattaaaggaattaagtaaagaacaagtagaaaaa
ttagttatagcatatgaaccaatttgggctataggaacaggaaaaactgccacagatgaa
caagcaaatgaaactataggatatataagaactgtagtaaaagctatgtatggtgagagc
gttgcagataaagtaagaattcaatacggtggatctgttaagcctggcactatcaaagct
caaatggctaaagaagagattgatggtgcattagtaggtggtgcaagcttaaaagcagaa
gattttgcggctatagtaaattattaa

DBGET integrated database retrieval system