KEGG   Clostridium botulinum A ATCC 3502: CBO0276Help
Entry
CBO0276           CDS       T00533                                 

Gene name
alr
Definition
alanine racemase (EC:5.1.1.1)
Orthology
K01775  
alanine racemase [EC:5.1.1.1]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
D-Alanine metabolism
Metabolic pathways
Class
Metabolism; Metabolism of other amino acids; D-Alanine metabolism [PATH:cbo00473]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
325579..326793
Genome map
AA seq 404 aa AA seqDB search
MFEHSRPAWIEINLDNLIHNMKEIRRVARSKEIISVVKADAYGHGALEIASLLLENGANR
LAVAVLSEALELRNSGITAPIIILGYTPLRYDERTICNNAETIIKNDLEVSVSSYKYAEQ
LSKKAQQLGKDVKIHVNIDTGMGRLGFLPTEENLEKIYQISKLPNIIFEGLFSHFSTADE
KNKEYTNEQFKKFLDFYYKLRDKNVKVNIKHIANSAALIDLPYTHLDAVRPGIAQYGYYP
SSEVNHKDINLRPIMTLKTNIVLVKDIKSGQSISYGRKFRTIRNSKIAVLPIGYADGYER
ELSNENNVYKAQVIVNGRRAPIVGRITMDMCMIDVTDIGDVKVGDEVILIGECNDERISV
EDIANLLNTIPYEVTSRISKRIPRYYIKDGKIVKISQINKEVNK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgtttgaacattctagacctgcatggattgaaataaatttagacaatttaattcataat
atgaaggaaataagaagagttgctagaagcaaggaaataataagtgtagttaaagcagat
gcatatggacatggtgctttagaaatagcctcccttttgctcgaaaacggagccaataga
ttggcagtagcagttctttcagaagcgctagaattaagaaatagtggtattacagcacct
attattattttaggctacactccactacgatatgacgaaagaacaatatgcaataatgct
gaaactataataaaaaatgacttagaggtatctgtaagttcatataaatatgcggagcaa
ttatctaagaaagcacaacaattaggcaaagatgtaaaaattcatgtaaacattgataca
ggtatgggaagattaggatttttgcccacagaagaaaatttagaaaaaatatatcaaata
agtaaactaccaaatataatatttgaaggcttgttttctcatttttcaacagcagatgaa
aagaataaagagtatactaatgaacaatttaaaaaattcttagatttttattataaactt
agagataaaaatgtgaaagttaatataaagcatattgccaatagtgctgctttaatagat
ttaccttacactcatttagatgctgttcgacctggtatagctcaatatggttattatcct
tcatcagaagtcaatcataaagatataaatttaagaccaataatgacattaaaaacaaat
attgttctagtgaaagacattaaatcaggacaatctatcagttatggaagaaaatttaga
acaataagaaatagcaagatagctgttcttccaataggttatgccgatggatatgaaaga
gaattatctaatgaaaataatgtttataaggctcaagttattgtgaacggaaggcgggca
cctatagtagggcgaataaccatggatatgtgtatgattgatgtaacagatataggtgat
gttaaagttggtgacgaagttatattaataggggaatgtaatgatgaaaggatttcagta
gaagacatagccaatttattgaataccataccttatgaagtaacaagcagaatcagtaaa
agaattccaaggtattatataaaagatggaaagatagtgaagatatcacaaataaataaa
gaagtaaacaaataa

DBGET integrated database retrieval system