KEGG   Clostridium botulinum A ATCC 3502: CBO0828Help
Entry
CBO0828           CDS       T00533                                 

Gene name
dhpS
Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CBO0828 (dhpS)
Enzymes [BR:cbo01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     CBO0828 (dhpS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
936659..937777
Genome map
AA seq 372 aa AA seqDB search
MNIFMNKNNITPLKIFNVLAPAANIIKQEILALGGDCAVNKYCINCKVETSDIILLGTKR
QYKKLLQKLKCMTFFRIEEIVGELENYIKNNGAVKTVLKDEREINYENLKVMGIINCTPD
SFYEGSRKDSTEEALKTAEKMLKEGAEILDIGGESTRPGSDPVDEEEEIKRVVPVIREIK
NKFKDVIISIDTYRANTAKSAIEAGADIVNDISAMKYDENMVKVVKEYNVPVILMHVKGK
PKDMQIDPVYENLMKEIHLYFNERIEYCKSHGITEDKIILDPGIGFGKTVEHNLKIMNRI
EELKSFNLPVLLAASRKATIGKVLGNLPTEERLEGTIALSCLAVDVGIQMVRVHDVKENI
RAIRMLEAVRKI
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaatatatttatgaataaaaataatattacccctttaaaaatttttaatgtgctagct
cctgcagccaatataataaagcaagaaatactggctttaggtggagattgtgctgtaaat
aaatattgtataaattgcaaagtggaaacttcagatataattttattaggaaccaaaaga
cagtacaaaaaattattgcaaaagcttaaatgcatgactttttttagaatagaagaaata
gtaggggaattagaaaactatattaaaaataatggagctgttaaaacagttctaaaggat
gaaagagaaataaactatgaaaatttaaaggttatgggaattataaattgtactccagat
tctttttatgagggttctagaaaagattctacagaagaagccttaaaaactgcagaaaag
atgttaaaagaaggtgcagaaattttagatataggcggagaatccacaagaccaggttct
gacccagtagatgaagaggaagaaataaaaagagtagttcctgttataagagagataaag
aataaatttaaggatgtcataatttccatagatacttatagagcaaatacggcaaagtct
gccatagaggcaggtgcagacatagtaaatgatataagtgctatgaagtatgatgaaaat
atggtgaaagtagttaaagaatacaatgtacctgtaatacttatgcatgtaaaaggaaaa
ccaaaggatatgcaaatagatccagtttatgagaatttaatgaaagaaattcatctttat
tttaatgagagaatagagtactgcaaatctcatggtataacagaggataaaataatatta
gatccaggcataggttttggaaaaactgtagagcataatctaaaaataatgaatagaata
gaagaattaaaaagctttaatcttccagtacttttagcagcctcaagaaaagctaccata
ggaaaagttttaggaaacttacctacagaagaaagattagaaggaaccatagctttatcc
tgtttagcggtagatgtaggaattcagatggtgagggtacacgatgtaaaagaaaatata
agagccataagaatgttagaggcagtaagaaaaatataa

DBGET integrated database retrieval system