KEGG   Clostridium botulinum A ATCC 3502: CBO0882Help
Entry
CBO0882           CDS       T00533                                 

Gene name
ascB
Definition
glycosyl hydrolase family protein (EC:3.2.1.86)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbo00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
986582..988003
Genome map
AA seq 473 aa AA seqDB search
MSGLAKDFLWGGATAANQCEGGYLEGNRGLGTVDVIPAGVNRRAVMQGKMHYNNLQEDSY
FPSHEAIDMYHNYKEDIALFAEMGFKCYRFSLSWSRIFPTGKEQEPNEEGLAFYEKFIDE
LLKYNIEPVVTICHFDVPLVLEQEYGSWRSRKLIDAYLRYCEAIFKRFNGKVKYWITFNE
INMLMHLPFMGAGIMFKEGENELEVKYQAAHNELVASALATKLAKEINKDNKVGCMLAAG
QFYPYTCKPEDVLEAMEKDKNNYFFIDVQSRGEYPSYAKKFLERNNIKIEMQSEDEKILR
ENTVDFIAFSYYTSRLASSDPNAGEKSAGNVITSLKNPHLKSSKWGWQIDPIGLRITMNS
LYDRYQKPLFIVENGLGAVDILNEDGTVDDDYRIAYLETHIKNMIDAVELDGVELLGYTT
WGCIDLVSASTGEMKKRYGFIYVDKDNDGHGTLKRYKKKSFYWYKNVIKNNGL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgagtggattagcaaaggatttcttgtggggcggagctacggcagctaaccaatgcgaa
ggtggttatttagaaggaaataggggattaggaactgtggatgttattccagcaggagta
aatcgtagagctgttatgcaaggaaagatgcattataataatttacaagaggattcttat
ttcccatcacatgaagcaatagatatgtatcataactacaaggaggatatagcattattt
gcagaaatgggatttaaatgttatcgtttctcactttcatggtcaagaattttcccaaca
ggaaaggaacaagaaccaaatgaagaaggcttagcattttatgaaaaatttattgatgag
ctattaaaatataatattgaaccagtagttaccatatgccattttgatgtacctcttgta
ttggagcaggaatatggttcatggagaagtagaaaattaatagatgcatatcttagatat
tgtgaagcaatatttaaaagatttaatgggaaagtaaagtattggataacttttaatgaa
ataaatatgcttatgcatttaccctttatgggagctggaataatgtttaaggaaggggaa
aatgagctagaagtaaaatatcaagcagctcataatgaattagtggcatcagccttagct
acaaaattagcaaaggaaattaataaagataataaagtaggatgtatgttagcggcaggg
caattctatccatatacttgtaagccagaagatgttctagaagctatggagaaagataaa
aataattatttcttcatagatgtacaatctaggggagaatacccgagctatgctaaaaaa
ttcttagagagaaacaatataaaaatagaaatgcagtcagaagatgagaagattttaagg
gagaatactgttgattttattgcatttagttactatacttcaagacttgcaagtagtgac
ccgaatgcaggagaaaaatcagctggtaatgtaataacatcattaaaaaatccacattta
aaatctagtaaatggggatggcaaatagatccaataggccttagaattacaatgaattca
ctttatgatcgttatcaaaaaccgctattcattgtggaaaatggcttaggtgctgttgat
attttaaatgaggatgggactgtagatgatgattatagaattgcttatcttgaaactcat
ataaaaaatatgattgatgcagttgaattagatggtgttgaactattaggatatacaact
tggggatgcattgatttagttagtgcatcaacaggggaaatgaaaaagcgatatggtttt
atatatgtagataaggataatgatggtcatggaactttaaagagatacaagaaaaaatct
ttctattggtacaaaaatgttattaaaaataatggactataa

DBGET integrated database retrieval system