KEGG   Clostridium botulinum A ATCC 3502: CBO0921Help
Entry
CBO0921           CDS       T00533                                 

Gene name
hemD
Definition
uroporphyrinogen III synthase/methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:cbo00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1027633..1029093
Genome map
AA seq 486 aa AA seqDB search
MSKVYLIGAGPGDEELITLKAIRALKKCTAVMYDRLANGELLKYLAPNCEIYYCGKEPGC
HYKSQDEINKMLVKLAKEGHIVGRIKGGDPYVFGRGGEEALDILEENIEFEVIPGVTSPV
SVLNYAGIPITHRGISRGFHIFTAMTKDKLDIDWKSVVNIGGTLVFLMGLGRLELITKGL
IENGMDKEGKVAVVMKGTTSKQKKVIGNLENIVEKVKEAKLESPVIIVVGEVVSFSDKLN
WYEKKPLFGRNICITRTKEQAKELKVQLLDLGAEVTEINSIEIKNTEDNLKSYLSKLKEY
DYIALTSVNAVKIFFDYLIKENIDIRNINAKFAAIGPATSEAIRIRGIMPSIKSKHFVAE
SLFEEMRKHIQKGDKILVPRSKDARPFLVDALRKEGCTVDEVHIYGTLCGQCTYTERFED
ADTVLFTSPSTVRNMISMVGIDSIKEKSIIAIGPITAAELDKNNIECSICDEYSINGIID
KLLDLN
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaagtatatttaattggtgcagggccaggtgatgaagaattaataactttaaaa
gccataagagccctaaaaaaatgtactgcagttatgtatgatagattagcaaatggagaa
ttgttaaaatatttagcaccaaattgtgaaatttattattgtggaaaagaaccgggctgt
cattataaaagccaggatgaaataaataaaatgctagttaaattagcaaaagaaggtcat
attgtaggaagaataaaaggtggagatccctatgtatttggaagagggggagaagaagcc
ttggatattttagaagaaaatatagaatttgaagttataccaggtgtaacttctccagta
tctgtactgaattatgcaggaattcctataacccatagaggaatatcaagagggtttcat
atttttacagctatgactaaggataaattagatatagattggaagtctgtagttaatata
ggaggaaccttagtatttttaatggggcttggaagattagaattaataactaaaggtctt
atagaaaatggaatggacaaagaaggtaaagtagcagtggttatgaaaggaactacctca
aagcaaaaaaaagttataggtaacttagaaaatatagtagaaaaagtaaaagaagctaaa
ctagagtcaccagtaataatagtagtaggagaagtagttagtttttcagataaattaaat
tggtatgaaaaaaagcctttattcggaagaaatatatgcataacccgtacaaaagagcaa
gctaaggaattaaaagttcaacttttagatttaggggctgaagttacagaaataaattct
atagaaataaaaaatacagaagataatttaaagtcttatttaagtaaattaaaggaatat
gattatatagctttaaccagtgtaaatgcagttaaaatattttttgattatttaattaaa
gaaaatatagatattagaaatattaatgctaaatttgcagctataggaccagctactagt
gaggcaataaggataagaggaataatgccaagcattaagtcaaagcattttgtagcagag
agtctttttgaagaaatgagaaagcatatacaaaagggagataaaatacttgtgcctcgt
tctaaagatgcaagaccatttcttgtggatgcattaagaaaagaaggttgtactgtggat
gaagtacatatatatggaaccctatgtggacaatgtacatatactgaaagatttgaagat
gcagatacagtattatttacaagtccatctactgttagaaatatgatttctatggtgggc
atagatagtataaaagaaaaaagtattatagcaataggtcctattacagcagcagaatta
gataaaaataatatagaatgtagtatttgtgatgaatattctataaatggcataatagat
aaacttttagaccttaactag

DBGET integrated database retrieval system