KEGG   Clostridium botulinum A ATCC 3502: CBO1134Help
Entry
CBO1134           CDS       T00533                                 

Gene name
nam
Definition
pyrazinamidase/nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    CBO1134 (nam)
Enzymes [BR:cbo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     CBO1134 (nam)
    3.5.1.-  
     CBO1134 (nam)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1248976..1249536
Genome map
AA seq 186 aa AA seqDB search
MFKSILIIDCQNDFISGSLACDNGEIAVKNIINLLNINKDLKVFYSLDWHSENNKSFKIN
GGIWPVHCVANRFGAKLEESFYKELQHKNHSPNNKKILFLKGKNDHIEEYSAYEGENILG
NKINEVLDKDVIVCGIASEFCVKETVEDLIRNGFNVKLYIDGVAYVNKKEHEKTLNNLRE
QGAKFI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtcaatacttataatagactgccaaaatgatttcatatcaggttcactggct
tgtgataatggagagatagctgttaaaaacattataaatttattaaatataaataaagat
ttaaaagtattttactctttagattggcatagtgaaaataataaatcttttaaaataaat
ggtggtatatggccagtacattgtgtagccaatagatttggtgctaaactagaggagagt
ttttataaagaattacaacataaaaatcattcacctaataataaaaaaatattgttttta
aaaggaaaaaatgatcatatagaagaatattcagcctatgaaggagaaaatattttaggt
aataagattaatgaagtattagataaggatgtaattgtatgtggtatagcttctgagttt
tgtgttaaagaaacggtagaggacttaattagaaatggatttaatgtgaaattatatata
gatggggtagcatatgtaaataaaaaagaacatgaaaaaactttaaataatttaagagag
cagggggctaaatttatttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system