KEGG   Clostridium botulinum A ATCC 3502: CBO1202Help
Entry
CBO1202           CDS       T00533                                 

Definition
glycosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBO1202
Enzymes [BR:cbo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CBO1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1320890..1322335
Genome map
AA seq 481 aa AA seqDB search
MKTNFPENFLWGGAVAANQCEGAYNIDGKGLSVQDVAPKGIKAGPTLEPTQDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRLSIAWSRIFPMGNEKEANEKGLQFYDDVFDECLKYGIQP
IVTLSHYETPLHLSKAYDGWKCREMIGFFNKYVCTVFNRYKDKVKYWLTFNEINSITHAP
FLSGGIYTPIEKLSKQEIYQAIHHELVASAMAVKACHEIIPDAKIGCMILGMPVYPLKPS
PEDMWETLNKERENFFFSDIQVRGYYPSYSKRFFKENNIKLDITNKDIEILKNTVDFISF
SYYMSICESSDKSIRAGEGNIIGGIPNPYLKASEWGWQIDPKGLRYYLNILYDRYQKPLF
IVENGLGAVDELVELGDGTKTVLDDYRISYLRDHLIQVSEAIEDGVDLMGYTSWGCIDLV
SFTTSELKKRYGFIYVDRNDDGTGTLERYKKKSFYWYKEVISSNGDIEALCSNISIEKDK
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaattttccagaaaattttttgtggggtggtgcagttgcagctaaccaatgt
gaaggagcttataatattgatggtaaaggattaagcgtgcaagatgtagcgccaaaggga
ataaaagctggtcctacattagagcctacacaagataatatgaaacttataggtatagat
ttttatcatagatataaagaagatattaagctttttgcagaaatggggtttaaggttttt
aggttatcaattgcgtggtcaagaatatttccaatggggaatgaaaaagaagcaaatgag
aagggactacaattttatgatgatgtttttgatgagtgcttaaagtatggaatacagcca
atagtaacattatcccattatgaaactccattgcatttatctaaagcttatgatggatgg
aaatgtcgtgagatgattggattttttaataagtatgtttgtacagtttttaatcggtat
aaagataaagtaaaatattggttaacctttaatgaaattaattcaattactcatgcacca
tttttaagtggtggaatttatacaccaatagaaaaattaagtaagcaagaaatttatcaa
gctattcatcatgaattagtagcaagtgcaatggcagtaaaagcgtgccatgaaattatt
cctgatgctaaaataggatgtatgattttggggatgcctgtatatccattgaaaccatca
ccagaagatatgtgggagactcttaataaagaaagagagaattttttcttttcagatatt
caagttcgcggttattatccctcatattcaaaaagattctttaaagaaaataatattaaa
ttagatattacaaataaagatatagaaatattaaaaaatactgtagattttatttcattt
agctattatatgagtatttgtgaatctagtgataaatctattagggcaggtgaaggaaat
attattggagggatacctaatccttatttaaaagcaagtgaatggggatggcaaattgat
cctaaaggactaaggtattatcttaatatattatatgatcgttatcaaaagccattattt
atagttgaaaatggattaggagctgtagatgaattagttgagttaggagatggaacaaaa
acagtattagatgattatagaatttcatatttaagagatcatttaattcaagtatcagaa
gcaatcgaggatggagtggacttaatgggatatacttcttgggggtgcattgatctggtt
agttttaccacttctgaattaaaaaaacgttatggatttatttatgtagatcgtaatgat
gatgggacagggacattagaacgttataagaaaaaaagcttttactggtataaagaagta
atttcaagtaatggagatattgaagcgctatgctcaaatattagtattgaaaaagataaa
atataa

DBGET integrated database retrieval system