KEGG   Clostridium botulinum A ATCC 3502: CBO1202Help
Entry
CBO1202           CDS       T00533                                 

Definition
glycosyl hydrolase family protein
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cbo00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1320890..1322335
Genome map
AA seq 481 aa AA seqDB search
MKTNFPENFLWGGAVAANQCEGAYNIDGKGLSVQDVAPKGIKAGPTLEPTQDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRLSIAWSRIFPMGNEKEANEKGLQFYDDVFDECLKYGIQP
IVTLSHYETPLHLSKAYDGWKCREMIGFFNKYVCTVFNRYKDKVKYWLTFNEINSITHAP
FLSGGIYTPIEKLSKQEIYQAIHHELVASAMAVKACHEIIPDAKIGCMILGMPVYPLKPS
PEDMWETLNKERENFFFSDIQVRGYYPSYSKRFFKENNIKLDITNKDIEILKNTVDFISF
SYYMSICESSDKSIRAGEGNIIGGIPNPYLKASEWGWQIDPKGLRYYLNILYDRYQKPLF
IVENGLGAVDELVELGDGTKTVLDDYRISYLRDHLIQVSEAIEDGVDLMGYTSWGCIDLV
SFTTSELKKRYGFIYVDRNDDGTGTLERYKKKSFYWYKEVISSNGDIEALCSNISIEKDK
I
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaaattttccagaaaattttttgtggggtggtgcagttgcagctaaccaatgt
gaaggagcttataatattgatggtaaaggattaagcgtgcaagatgtagcgccaaaggga
ataaaagctggtcctacattagagcctacacaagataatatgaaacttataggtatagat
ttttatcatagatataaagaagatattaagctttttgcagaaatggggtttaaggttttt
aggttatcaattgcgtggtcaagaatatttccaatggggaatgaaaaagaagcaaatgag
aagggactacaattttatgatgatgtttttgatgagtgcttaaagtatggaatacagcca
atagtaacattatcccattatgaaactccattgcatttatctaaagcttatgatggatgg
aaatgtcgtgagatgattggattttttaataagtatgtttgtacagtttttaatcggtat
aaagataaagtaaaatattggttaacctttaatgaaattaattcaattactcatgcacca
tttttaagtggtggaatttatacaccaatagaaaaattaagtaagcaagaaatttatcaa
gctattcatcatgaattagtagcaagtgcaatggcagtaaaagcgtgccatgaaattatt
cctgatgctaaaataggatgtatgattttggggatgcctgtatatccattgaaaccatca
ccagaagatatgtgggagactcttaataaagaaagagagaattttttcttttcagatatt
caagttcgcggttattatccctcatattcaaaaagattctttaaagaaaataatattaaa
ttagatattacaaataaagatatagaaatattaaaaaatactgtagattttatttcattt
agctattatatgagtatttgtgaatctagtgataaatctattagggcaggtgaaggaaat
attattggagggatacctaatccttatttaaaagcaagtgaatggggatggcaaattgat
cctaaaggactaaggtattatcttaatatattatatgatcgttatcaaaagccattattt
atagttgaaaatggattaggagctgtagatgaattagttgagttaggagatggaacaaaa
acagtattagatgattatagaatttcatatttaagagatcatttaattcaagtatcagaa
gcaatcgaggatggagtggacttaatgggatatacttcttgggggtgcattgatctggtt
agttttaccacttctgaattaaaaaaacgttatggatttatttatgtagatcgtaatgat
gatgggacagggacattagaacgttataagaaaaaaagcttttactggtataaagaagta
atttcaagtaatggagatattgaagcgctatgctcaaatattagtattgaaaaagataaa
atataa

DBGET integrated database retrieval system