KEGG   Clostridium botulinum A ATCC 3502: CBO1556Help
Entry
CBO1556           CDS       T00533                                 

Gene name
folE
Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    CBO1556 (folE)
Enzymes [BR:cbo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     CBO1556 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1688844..1689434
Genome map
AA seq 196 aa AA seqDB search
MAIDVKAIEEHIRGILIALGDNPEREGLKNTPKRVAKMYEEVFKGMCYSNDEIAEMFNVT
FEDDLCINDNENDMVFMKEIEIFSHCEHHLALMYNMKVAIAYIPKKKIIGLSKIARIADM
VGRRLQLQERIGSDIAEILQKITDSEDVAVIIEGEHGCMTTRGIKKPGTKTITTTLRGKF
NTDPIVSNKLMMLYTK
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggcaattgatgttaaagcaattgaagaacacataaggggaattttgatagctttagga
gacaacccagaaagagaaggtctaaagaacacaccaaaacgtgtagctaaaatgtatgaa
gaagtattcaaaggtatgtgttatagcaatgatgaaattgcagaaatgtttaatgtaacc
tttgaagatgatttatgtataaatgataatgaaaatgacatggtttttatgaaggaaata
gaaatatttagtcattgtgaacatcatttagcacttatgtacaatatgaaagtagccata
gcatatatacctaagaaaaaaattattggtttaagcaaaatagcacgaatagcagatatg
gtaggacgtagactacagcttcaagagaggattggaagtgatatagcagaaatacttcag
aagataactgactcagaagatgtagctgttattatagaaggagaacatggctgtatgact
actagaggaataaagaagccaggtactaaaactataacaactacattaaggggaaagttt
aacacagatcctattgtaagcaataaattaatgatgctttatacgaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system