KEGG   Clostridium botulinum A ATCC 3502: CBO1602Help
Entry
CBO1602           CDS       T00533                                 

Gene name
glcK
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBO1602 (glcK)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBO1602 (glcK)
   00052 Galactose metabolism
    CBO1602 (glcK)
   00500 Starch and sucrose metabolism
    CBO1602 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    CBO1602 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CBO1602 (glcK)
   00524 Butirosin and neomycin biosynthesis
    CBO1602 (glcK)
Enzymes [BR:cbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CBO1602 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1735880..1736827
Genome map
AA seq 315 aa AA seqDB search
MNKKYVVGVDLGGTKIYTALVDLDGNIIKEKNVKTEASKGELDVLYKIINTIDNVIEGVN
LEEIKAIGIGLPGPLDAKEGIIISSSNLPFENFSLVQPIKDKYNIPTYLDNDANVATLAE
FMFGKGKGTQNMIYVTASTGIGAGAIINSRIYRGNTGNALEIGHTTVMKDGPNCGCGNKG
CAESLGSGTAIMKKAKEVCKNNGETSLKKYDNLTAKEVFEEAKKGDKLSKEVLEFCLSYL
GITVANIINTFDPEMVVIGGGVINGGEIVCDIINREVKNRCWKAIRDNCKITKAKLAGKA
GVLGAAALAITESKN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaatatgtagtgggtgttgatttagggggaacaaagatttatacagcactt
gtggatttagatggaaatataataaaagaaaaaaatgttaaaactgaagcaagcaaagga
gaacttgatgtattatataaaataataaatactattgataatgttatagaaggagtaaac
ttagaggaaataaaggctataggaataggtttaccaggacctttagatgctaaagaaggt
ataataatttcatcttcaaatctaccctttgaaaattttagcttagttcaacctataaag
gataaatataatattccaacatacctagacaatgatgctaatgtagctactttagctgaa
tttatgtttggtaaaggaaaaggtacccagaacatgatatacgtaacagcaagtacaggc
attggagcaggagctataataaatagcagaatatatagaggaaatacaggaaatgcttta
gaaataggtcatacaactgttatgaaggatggaccgaactgtggttgtggtaataagggt
tgcgcagaaagtttaggttctggtactgccattatgaaaaaggcaaaagaagtttgtaaa
aataatggagagacatctttaaaaaaatatgataatctaactgcaaaggaagtttttgaa
gaagctaaaaaaggagataagctttcaaaagaagtactagaattttgcttatcctattta
ggtataactgtagccaatataataaatacttttgatccagaaatggttgttataggcgga
ggagttataaatggtggagaaattgtttgtgatataataaatagagaagtgaaaaataga
tgctggaaagctattagagataattgtaaaataacaaaagcaaagcttgcaggaaaagca
ggggttctaggagctgcagccttagctataactgaaagtaaaaattaa

DBGET integrated database retrieval system