KEGG   Clostridium botulinum A ATCC 3502: CBO1602Help
Entry
CBO1602           CDS       T00533                                 

Gene name
glcK
Definition
(RefSeq) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
cbo00010  Glycolysis / Gluconeogenesis
cbo00052  Galactose metabolism
cbo00500  Starch and sucrose metabolism
cbo00520  Amino sugar and nucleotide sugar metabolism
cbo00521  Streptomycin biosynthesis
cbo01100  Metabolic pathways
cbo01110  Biosynthesis of secondary metabolites
cbo01120  Microbial metabolism in diverse environments
cbo01130  Biosynthesis of antibiotics
cbo01200  Carbon metabolism
Module
cbo_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
cbo_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBO1602 (glcK)
   00052 Galactose metabolism
    CBO1602 (glcK)
   00500 Starch and sucrose metabolism
    CBO1602 (glcK)
   00520 Amino sugar and nucleotide sugar metabolism
    CBO1602 (glcK)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    CBO1602 (glcK)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    CBO1602 (glcK)
Enzymes [BR:cbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     CBO1602 (glcK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase FGGY_N IF2_N DUF460
Motif
Other DBs
NCBI-GeneID: 5185857
NCBI-ProteinID: YP_001254107
UniProt: A5I275
Position
1735880..1736827
Genome map
AA seq 315 aa AA seqDB search
MNKKYVVGVDLGGTKIYTALVDLDGNIIKEKNVKTEASKGELDVLYKIINTIDNVIEGVN
LEEIKAIGIGLPGPLDAKEGIIISSSNLPFENFSLVQPIKDKYNIPTYLDNDANVATLAE
FMFGKGKGTQNMIYVTASTGIGAGAIINSRIYRGNTGNALEIGHTTVMKDGPNCGCGNKG
CAESLGSGTAIMKKAKEVCKNNGETSLKKYDNLTAKEVFEEAKKGDKLSKEVLEFCLSYL
GITVANIINTFDPEMVVIGGGVINGGEIVCDIINREVKNRCWKAIRDNCKITKAKLAGKA
GVLGAAALAITESKN
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaatatgtagtgggtgttgatttagggggaacaaagatttatacagcactt
gtggatttagatggaaatataataaaagaaaaaaatgttaaaactgaagcaagcaaagga
gaacttgatgtattatataaaataataaatactattgataatgttatagaaggagtaaac
ttagaggaaataaaggctataggaataggtttaccaggacctttagatgctaaagaaggt
ataataatttcatcttcaaatctaccctttgaaaattttagcttagttcaacctataaag
gataaatataatattccaacatacctagacaatgatgctaatgtagctactttagctgaa
tttatgtttggtaaaggaaaaggtacccagaacatgatatacgtaacagcaagtacaggc
attggagcaggagctataataaatagcagaatatatagaggaaatacaggaaatgcttta
gaaataggtcatacaactgttatgaaggatggaccgaactgtggttgtggtaataagggt
tgcgcagaaagtttaggttctggtactgccattatgaaaaaggcaaaagaagtttgtaaa
aataatggagagacatctttaaaaaaatatgataatctaactgcaaaggaagtttttgaa
gaagctaaaaaaggagataagctttcaaaagaagtactagaattttgcttatcctattta
ggtataactgtagccaatataataaatacttttgatccagaaatggttgttataggcgga
ggagttataaatggtggagaaattgtttgtgatataataaatagagaagtgaaaaataga
tgctggaaagctattagagataattgtaaaataacaaaagcaaagcttgcaggaaaagca
ggggttctaggagctgcagccttagctataactgaaagtaaaaattaa

DBGET integrated database retrieval system