KEGG   Clostridium botulinum A ATCC 3502: CBO1633Help
Entry
CBO1633           CDS       T00533                                 

Gene name
acoC
Definition
(RefSeq) TPP-dependent acetoin dehydrogenase complex, E2 component, dihydrolipoamide acetyltransferase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
cbo00010  Glycolysis / Gluconeogenesis
cbo00020  Citrate cycle (TCA cycle)
cbo00620  Pyruvate metabolism
cbo01100  Metabolic pathways
cbo01110  Biosynthesis of secondary metabolites
cbo01120  Microbial metabolism in diverse environments
cbo01130  Biosynthesis of antibiotics
cbo01200  Carbon metabolism
Module
cbo_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CBO1633 (acoC)
   00020 Citrate cycle (TCA cycle)
    CBO1633 (acoC)
   00620 Pyruvate metabolism
    CBO1633 (acoC)
Enzymes [BR:cbo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     CBO1633 (acoC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Motif
Other DBs
NCBI-GeneID: 5185888
NCBI-ProteinID: YP_001254135
UniProt: A5I2A3
Position
1771205..1772515
Genome map
AA seq 436 aa AA seqDB search
MGKLEVMPKLGLTMTEGELVKWHKKEGDTIKVGETLFDVTTDKLTNNVEAKADGIVRKIL
VDEGTVVECLKPVAIIGDKDEDISNLLRESLQDSKGNEVEKEVKESKEEIKDNRKIKKGE
RTKISPIAKRLAKENDVDIQLLDGTGPEGRIVLKDVESYIENNKNNIKTSPVAEKIAKDL
GVNLEGIKKDGRIMKDDILEFIQKSIPSVGEDLMDRRVKMSTMRKVIASRMSESSKISPT
VTYDIEVDMTNLKRLKEQIKNEWKVTYTDLLVKIVSKVLIQYPLVNCSIEGDEMIFRNYS
NIGVAVALEEGLVVPVVKYANQKGLKDISIEVKELAHKAKNNGLTEENSTGGTFTITNLG
MFGIKSFSPIINQPEVAILGVNMITNTPVVENGEIVIKPLMSLSLTADHRAVDGAVAAQF
LKAVKKYMEKPELLIL
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggtaagctagaggttatgccaaagctgggattaactatgacagagggtgaactagtt
aaatggcataaaaaagaaggagatactataaaggtaggagagaccttatttgatgtaaca
acggataaattgactaataatgtggaagcaaaggctgatggaattgtaagaaagatttta
gtagatgaaggtacagtagttgaatgtttgaaaccagtagccataattggagataaagat
gaggatatatcaaatctattaagggaatctttgcaagatagtaagggaaatgaggtagaa
aaagaagttaaagaatctaaggaggagataaaagataataggaaaataaaaaaaggagaa
agaacaaagatatccccaatagcaaaaagacttgcaaaggaaaatgatgtggatattcaa
ctattagatggaacagggcctgaaggaagaatagttttaaaagatgtagaatcatatata
gaaaataataagaataatattaaaacttctccagtagcagagaagatagctaaagattta
ggcgttaatttagaaggtataaagaaagacggaagaataatgaaagatgatatattagaa
tttatccaaaaatctattccttctgtaggagaagatttaatggatagaagagtaaaaatg
agcactatgagaaaagtaattgcctcaagaatgagcgaaagttcaaagatttctcctaca
gtgacctatgacattgaagtggatatgactaatttaaaaaggttaaaggaacaaattaaa
aatgaatggaaagttacttatacagatttattagtaaaaatagtttctaaagtactcatt
caatatcctttagttaattgctcaatagaaggagatgaaatgatttttagaaattattca
aatattggagtagcagtggctttagaggaaggccttgtggtaccagtggttaaatatgca
aaccaaaagggactaaaggatatttctatagaagtgaaagaattagcccacaaagctaaa
aataatggacttactgaagaaaatagtactggaggaacttttactataactaatcttggt
atgtttggtataaagtctttttctccaattataaatcagcctgaagtagctatattaggt
gtgaatatgataactaatactccagtggtagagaatggagaaatagtgataaaacctctt
atgagtttatctcttactgcagaccatagggcggtagatggtgctgtagcggctcaattc
ttaaaagcagttaaaaaatatatggaaaagccagagttgcttatattgtag

DBGET integrated database retrieval system