KEGG   Clostridium botulinum A ATCC 3502: CBO1638Help
Entry
CBO1638           CDS       T00533                                 

Gene name
thrC
Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CBO1638 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CBO1638 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CBO1638 (thrC)
Enzymes [BR:cbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CBO1638 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1778829..1780310
Genome map
AA seq 493 aa AA seqDB search
MFYKSTRGEGKNVKASEAIIRGIAEDGGLYVPEELPKIDKSFKELKNMNYKELAFYIMKK
YFDDFNEEELKECIDKAYDSKFENPLIAPLNYKAGAYFLELYHGKTLAFKDMALSILPHL
LKTSAKKMNITKDIVILTATSGDTGKAALEGFDSVEGTKIVVFYPKDGVSEIQKRQMVTQ
EGKNTFVVGIDGNFDDAQSGVKEIFNDRDFNGLLEERGYMFSSANSINIGRLVPQIVYYV
YSYVNLLKDKKVGEGENINIVVPTGNFGNILAAFYAKNMGIPVGRLICASNENKVLTDFI
NTGIYDRRRKFSVTNSPSMDILISSNLERFLYEISGKDSRLIKNLMTELKEKGKYEITEE
MKKRLDILYGDFSDEDDTLKAIEKVYESSDYLIDTHTAVAYDVYEKYKNKTGDNSATIIA
STASPFKFPKSINEVLDMGHENASDFELVNLFSDKLNLKLPKGLEGLEEKEICHKVTCKK
DEMKKVIKNFLGI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgttttataaaagtactaggggagaagggaaaaatgttaaagcatcagaggcaataatt
agaggaatagctgaggatggaggattatatgtaccagaagagcttcctaaaatagataag
agttttaaagaattaaaaaacatgaattataaggaattagcattttatattatgaaaaag
tactttgatgattttaatgaagaggaacttaaagaatgtatagataaagcctatgacagt
aagtttgagaatcctcttatagcaccattaaattataaagctggagcatattttttagaa
ctttatcatgggaaaacattagcctttaaagatatggctttaagtatacttccgcacctt
ttaaaaacctcagcaaaaaagatgaatataactaaagacatagttatattaacagctact
tcaggagatactggaaaagctgctctagaaggatttgatagtgtagagggcacaaagata
gtggtattttatcctaaggatggggtaagtgaaattcaaaaaagacagatggttacacaa
gaggggaagaatactttcgtagtaggcatagatgggaatttcgatgatgctcaaagtgga
gttaaggaaatatttaatgatagagattttaatggattattagaggaaaggggatacatg
ttttcctctgctaattctataaatataggaagactagtaccgcaaatagtatactatgtt
tattcttatgtgaatctacttaaagataaaaaagtaggggaaggagaaaatataaacata
gttgttcctacaggaaattttggtaacattttagcagccttttacgctaaaaatatggga
ataccagtgggaagattaatttgtgcatctaatgagaataaggtgctaacagattttata
aatactggaatatacgataggagaagaaaattttctgttactaattctccttctatggat
attttaatatctagtaacttggaaagatttttgtatgaaataagtggaaaagattcacgc
cttataaaaaatctcatgacagaacttaaagaaaagggtaaatatgagataacagaggaa
atgaagaagagattagatatattatatggagatttttcggatgaagatgatacacttaaa
gctattgaaaaagtctatgaaagttctgattatcttatagatactcatactgcagtagct
tatgatgtttatgaaaaatataaaaataaaacaggagataatagtgctactataatagca
tctaccgcaagtccatttaaatttcccaaaagtataaatgaagtattagatatgggacat
gaaaatgcttcagattttgaattagttaatttattttcagataaattaaatttaaagttg
cctaaaggattagaaggactagaggaaaaagaaatttgtcataaggtcacttgtaaaaag
gatgaaatgaagaaagtaattaaaaattttttaggaatatag

DBGET integrated database retrieval system