KEGG   Clostridium botulinum A ATCC 3502: CBO1638Help
Entry
CBO1638           CDS       T00533                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CBO1638 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    CBO1638 (thrC)
Enzymes [BR:cbo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     CBO1638 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
1778829..1780310
Genome map
AA seq 493 aa AA seqDB search
MFYKSTRGEGKNVKASEAIIRGIAEDGGLYVPEELPKIDKSFKELKNMNYKELAFYIMKK
YFDDFNEEELKECIDKAYDSKFENPLIAPLNYKAGAYFLELYHGKTLAFKDMALSILPHL
LKTSAKKMNITKDIVILTATSGDTGKAALEGFDSVEGTKIVVFYPKDGVSEIQKRQMVTQ
EGKNTFVVGIDGNFDDAQSGVKEIFNDRDFNGLLEERGYMFSSANSINIGRLVPQIVYYV
YSYVNLLKDKKVGEGENINIVVPTGNFGNILAAFYAKNMGIPVGRLICASNENKVLTDFI
NTGIYDRRRKFSVTNSPSMDILISSNLERFLYEISGKDSRLIKNLMTELKEKGKYEITEE
MKKRLDILYGDFSDEDDTLKAIEKVYESSDYLIDTHTAVAYDVYEKYKNKTGDNSATIIA
STASPFKFPKSINEVLDMGHENASDFELVNLFSDKLNLKLPKGLEGLEEKEICHKVTCKK
DEMKKVIKNFLGI
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
ttgttttataaaagtactaggggagaagggaaaaatgttaaagcatcagaggcaataatt
agaggaatagctgaggatggaggattatatgtaccagaagagcttcctaaaatagataag
agttttaaagaattaaaaaacatgaattataaggaattagcattttatattatgaaaaag
tactttgatgattttaatgaagaggaacttaaagaatgtatagataaagcctatgacagt
aagtttgagaatcctcttatagcaccattaaattataaagctggagcatattttttagaa
ctttatcatgggaaaacattagcctttaaagatatggctttaagtatacttccgcacctt
ttaaaaacctcagcaaaaaagatgaatataactaaagacatagttatattaacagctact
tcaggagatactggaaaagctgctctagaaggatttgatagtgtagagggcacaaagata
gtggtattttatcctaaggatggggtaagtgaaattcaaaaaagacagatggttacacaa
gaggggaagaatactttcgtagtaggcatagatgggaatttcgatgatgctcaaagtgga
gttaaggaaatatttaatgatagagattttaatggattattagaggaaaggggatacatg
ttttcctctgctaattctataaatataggaagactagtaccgcaaatagtatactatgtt
tattcttatgtgaatctacttaaagataaaaaagtaggggaaggagaaaatataaacata
gttgttcctacaggaaattttggtaacattttagcagccttttacgctaaaaatatggga
ataccagtgggaagattaatttgtgcatctaatgagaataaggtgctaacagattttata
aatactggaatatacgataggagaagaaaattttctgttactaattctccttctatggat
attttaatatctagtaacttggaaagatttttgtatgaaataagtggaaaagattcacgc
cttataaaaaatctcatgacagaacttaaagaaaagggtaaatatgagataacagaggaa
atgaagaagagattagatatattatatggagatttttcggatgaagatgatacacttaaa
gctattgaaaaagtctatgaaagttctgattatcttatagatactcatactgcagtagct
tatgatgtttatgaaaaatataaaaataaaacaggagataatagtgctactataatagca
tctaccgcaagtccatttaaatttcccaaaagtataaatgaagtattagatatgggacat
gaaaatgcttcagattttgaattagttaatttattttcagataaattaaatttaaagttg
cctaaaggattagaaggactagaggaaaaagaaatttgtcataaggtcacttgtaaaaag
gatgaaatgaagaaagtaattaaaaattttttaggaatatag

DBGET integrated database retrieval system