KEGG   Clostridium botulinum A ATCC 3502: CBO1935Help
Entry
CBO1935           CDS       T00533                                 

Gene name
aorA
Definition
aldehyde ferredoxin oxidoreductase
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    CBO1935 (aorA)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    CBO1935 (aorA)
Enzymes [BR:cbo01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.5  aldehyde ferredoxin oxidoreductase
     CBO1935 (aorA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2061097..2062914)
Genome map
AA seq 605 aa AA seqDB search
MYGYNGKILRIDLTNRNCTLEPLDEEKAKKFIGARGLGVKTLLEEIDPKIDPLSIENKLV
IVTGPITGAPMPTSGRYMVVTKAPLTGTIAISNSGGKWGTELKNAGYDMIIVQGKSEVPV
YVNIEDDKIEIKEAEHLWGKTSLETTKILCNENNERAKVLCIGPAGEKLSLMAAIMNDID
RAAGRGGVGAVMGSKNLKAIVVKGSGKVKVVNGEEAKKISLEKIKILREDPVAGGGLPTY
GSAVLVNIINENGVHPVRNFQKSYTDEADKISGETLTEDCLVRKNPCYRCPIACGRWVKL
DDGTECGGPEYETLWSFGSDCDVYDLNAINVANMLCNEYGLDTISAGATIAAAMELYEKG
YIKDEDIKEDGLSLKWGDAEAVVGWTKKMALREGFGDKMADGSYRLCESYGVPEFSMTVK
KQELPAYDPRGIQGHGITYAVNNRGGCHIKGYMISPEILGYPEKLDRFSLEGKAAYAKIF
HDLTAVIDSLGLCIFTTFGLGVQDYVDMYNVVVGGKLHNAESIMEAGDRIWTLEKLFNLE
AGIDSSHDTLPKRLLKEPIPEGPSKGCVHKLSELLPEYYAVRGWDKNGIPTEDTLKKLGL
EEYIK
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtatggttataatggaaagattttaagaattgatttaacaaatagaaattgtacttta
gagcctttagatgaagaaaaggctaaaaaatttataggagctagaggacttggggttaag
actttattagaagaaatagaccctaaaatagatccattgtctattgaaaataaacttgtt
atagttacaggccctattactggagctcctatgccaacaagtggtagatatatggtagta
acaaaggctcctttgactgggactattgcaatatcaaactctggtggaaaatggggaaca
gaacttaaaaatgcaggatacgatatgataatagtacaaggtaaatcagaggttcctgtt
tatgtaaacatagaagatgataaaatagaaataaaagaagcagagcatctatggggtaag
acttcattagaaactacaaaaattctttgtaatgagaacaatgaaagagcaaaagtacta
tgtataggacccgcaggagaaaagttatctcttatggcagctattatgaatgatatagat
agagcagcaggaagaggtggcgttggagctgtaatgggttcaaagaatttaaaagccata
gtggttaaaggttctggaaaagttaaagtagtcaatggagaggaagcaaaaaaaatatcc
ttagaaaaaattaaaatattaagagaagatccagtggcaggtggaggactacctacttat
ggttctgctgtacttgtaaatataattaatgaaaatggtgtacatcccgtgagaaatttc
caaaaatcttatacagatgaggctgataaaataagtggagaaacccttacagaggattgc
cttgtaagaaaaaatccatgttatagatgtccaatagcctgcggtagatgggtaaaatta
gatgatggcacagaatgtggaggcccagagtatgaaactttatggtcctttggatctgat
tgtgatgtatatgatctaaatgctattaatgtagctaatatgctttgtaatgaatatggt
cttgatacaatttcagcaggagcaactattgcagcagctatggaattatacgaaaaagga
tatataaaagatgaggatataaaagaggatggattatctttaaaatggggagatgcagag
gctgttgttggatggacaaaaaagatggcattaagagaaggttttggagataagatggca
gatggatcctatagattatgtgaatcctatggtgttccagagttttctatgacagttaaa
aagcaagaattaccagcctatgacccaagaggaattcaaggacatggtataacttatgca
gttaataatagaggtggttgtcatataaaaggttatatgataagtccggaaatactagga
tatccagaaaaacttgacagattctctctagaaggaaaggcagcttatgctaaaatattt
cacgatttaacagctgtaatagattctttaggattgtgtatatttacaacttttggactt
ggcgtacaggattatgtagatatgtataatgtagttgtaggtggtaagttacataatgca
gaatctataatggaagcaggagatagaatttggacattagaaaagttatttaatttagaa
gctggtatagacagttcccatgatacccttccaaaaagattgcttaaagaacctattcca
gagggaccttctaagggatgtgttcataaattaagtgaattacttccagaatactatgca
gtaagaggatgggacaagaatggtataccaacagaggatacattaaaaaaattaggtctt
gaagaatatataaagtag

DBGET integrated database retrieval system