KEGG   Clostridium botulinum A ATCC 3502: CBO2108Help
Entry
CBO2108           CDS       T00533                                 

Gene name
eutE
Definition
acetaldehyde dehydrogenase
Orthology
K00132  
acetaldehyde dehydrogenase (acetylating) [EC:1.2.1.10]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Benzoate degradation
Pyruvate metabolism
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:cbo00620]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cbo00650]
Metabolism; Xenobiotics biodegradation and metabolism; Benzoate degradation [PATH:cbo00362]
Metabolism; Xenobiotics biodegradation and metabolism; Xylene degradation
Metabolism; Xenobiotics biodegradation and metabolism; Dioxin degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2248007..2249605)
Genome map
AA seq 532 aa AA seqDB search
MENFDKDLRSIQQARDLARLGKVAADKIADYTEEQIDKILRNMVRVAEENAVCLAQMAVE
ETGFGKVEDKTFKNHLAATILYNSIKDMKTIGVINEDKENKLIELAEPVGLVMGIVPSTN
PTSTAIFKAMISIKSRNAIVFAPHPAAAKCTIKAVELMRDAAIEAGAPENIISAVTIPTI
GATNELMKSKEVAIIIATGGPGMVKAAYSSGTPAIGVGAGNSPAYIERTANVEKAVKNII
ASKTFDNGTICASEQSIICEECNHDLVVAEFKKQGGYFMTEEETEKVCKLLFKKGNAMNA
KFVGRSPQVIASAAGFTIPAGTKVLIGRQNGVGEGYPLSFEKLTTVLGFYTVKDWHEACE
LSIKLLQNGIGHTISIHTEDRDMVMKFARKPASRILVNTGGTQGGTGASTGLNPSFTLGC
GTWGGSSVSENVTPKHLMNIKRVAYGIKDCTNLASNDPTFNCIKTAENCHGVQNQFMNMS
PAQIAAAAEVLNKANNCAENTNTCTECSNENTKNEELLDLVNQIVAAMKGAN
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atggaaaactttgataaggatttgcgttcaatacaacaagcgagagatcttgctagactt
ggaaaagtagcagctgataaaattgctgattatactgaagagcaaattgacaaaatttta
cgtaatatggtaagagttgcagaagaaaacgctgtttgtttagcacaaatggcagttgaa
gagacaggctttggtaaagttgaagataaaactttcaaaaaccacttagcagctactata
ctttataattcaattaaagatatgaaaactataggtgtaattaatgaagataaggaaaat
aagcttatagaacttgctgaaccagttggcttagttatgggtatagtaccttcaacaaac
ccaacttctaccgcaattttcaaagctatgatttcaatcaaatctcgtaatgctatagtg
ttcgcaccacatccagctgctgcaaaatgtacaattaaagcagttgaattaatgagggat
gcagcaatagaagctggagcaccagaaaacattataagtgctgtaactattccaacaatt
ggagctacaaatgaattaatgaaaagcaaagaagtagctataataatagctacaggtggt
ccaggaatggttaaagctgcttatagctcaggaacaccagctattggtgttggtgcagga
aactctccagcatacattgaaagaactgctaatgtagaaaaagctgttaaaaacattatt
gcaagtaaaacttttgataatggtacaatctgtgcatcagaacaatcaataatctgtgaa
gaatgtaatcatgacctagttgttgcagaatttaaaaaacaaggtggatacttcatgaca
gaagaagaaactgaaaaagtttgtaaactattattcaaaaaaggtaatgctatgaatgct
aaatttgttggaagaagtccacaagttatagcaagtgctgcaggattcacaattccagca
ggaactaaagtacttataggaagacaaaatggagtaggagaaggttacccattatctttt
gaaaaacttacaacagttcttggattctatacagtaaaagattggcatgaagcatgtgaa
ttaagtattaaattacttcaaaatggaattggtcacacaattagcatccatacagaagat
agagacatggttatgaagtttgctagaaaaccagcttcccgtatccttgttaacactggt
ggaactcaaggtggaacaggtgcaagtacaggtcttaatccttcatttactttaggatgc
ggtacttggggaggaagctcagtatctgaaaatgttactccaaagcaccttatgaacatt
aaaagagttgcttatggtataaaagattgcacaaatttagcatctaatgacccaactttt
aactgcataaaaactgctgaaaactgtcatggagttcaaaatcaatttatgaatatgagc
ccagcacaaattgcagcagctgcagaagttttaaataaggctaataattgcgctgaaaac
actaatacttgcactgaatgcagtaatgaaaatacaaaaaatgaagaacttttagattta
gttaatcaaatagttgccgctatgaagggggcaaactaa

DBGET integrated database retrieval system