KEGG   Clostridium botulinum A ATCC 3502: CBO2784Help
Entry
CBO2784           CDS       T00533                                 

Gene name
glpK
Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Glycerolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:cbo00561]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2947271..2948767)
Genome map
AA seq 498 aa AA seqDB search
MEKYIMSLDQGTTSSRCIIFNKKGEIVSVAQKEFTQIYPKAGWVEHDPLEIWGKQAGVAG
EALNIARISPEQIAGIGITNQRETTVVWNKRTGMPVYNAIVWQCRRTAGYCDELREKGID
KTIKEKTGLMLDAYFSATKIKWILDNVEGARELAEKGDLLFGNIDTWLIWNMTKGKIHVT
DYTNASRTMLFNIHELKWDEELLEILDIPKSMLPEVKPSSCVYGETDEILFGVSIPIAGD
AGDQQAALFGQTCFNAGMAKNTYGTGCFLLMNTGEKAVDSKNGLLTTIAVGIDGKVEYAL
EGSIFIGGAVIQWLRDELRMVKTAQETEKYATEVEDNNGVYLVPAFVGIGAPYWDSYARG
TILGLTRGAKKEHIIRAALESMAYQTHDVLKAMEEDSGIELKALKVDGGACQNNFLMQFQ
SDILGVEVDRPEVVETTALGAAYLAGLAVGYWKDRNEISQNWAISRSFAPAMEDEKKEKL
IKGWHKAVTKAMDWEERE
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggaaaagtatataatgtctttagatcaaggaactactagttcaagatgtataatattt
aataaaaaaggtgaaatagtaagtgttgctcaaaaggaatttacacaaatatatcctaaa
gcaggatgggtagaacatgatccactagaaatatggggaaaacaagcaggggtagcagga
gaggcattaaatatagctagaatttctccagaacaaatagcaggtataggtataactaat
caaagagaaactacagtagtttggaataaaagaacaggaatgcccgtatataatgctata
gtatggcaatgtagaagaacagctggttattgtgatgaattaagagaaaaaggtatagat
aaaactataaaagaaaaaacaggtctaatgctagatgcctatttttcagcaacaaaaata
aaatggatattagataatgtagagggagctagagaattagcagaaaaaggtgatttgtta
tttggaaatatagatacttggttaatctggaatatgacaaaggggaaaattcatgtaaca
gattatactaatgcttcaagaactatgttatttaacatacatgaattaaaatgggatgaa
gaattattagaaatacttgatattcctaaatctatgcttccagaagtaaaaccatctagt
tgtgtatatggtgaaacagatgaaatattgttcggtgtatcaattccaatagccggagat
gcaggagatcaacaagcagctttgtttggtcaaacttgctttaatgcgggtatggctaaa
aatacttatggtacaggttgtttcttgttgatgaatacaggagaaaaagcagtagattct
aaaaatggattattaactactatagctgtgggtatagatggaaaagttgaatatgcttta
gaaggaagtatatttataggtggagcagtaattcaatggctaagagatgaacttagaatg
gtaaaaactgctcaagaaacagaaaaatatgccacagaagtagaagataataatggagtt
taccttgtgccagcttttgtcggaataggtgcaccatactgggattcttatgcaagggga
actatattaggccttacaagaggagctaaaaaagaacacataataagagctgcattagaa
tctatggcataccaaactcatgatgttttaaaagctatggaagaggactcaggtatagaa
ctaaaagcattaaaagtagatgggggagcctgtcaaaataatttcttaatgcaatttcaa
tctgatatattaggtgtagaagtagatagaccagaagtagtagagactacagcattagga
gcagcttatcttgcaggacttgcagtaggatattggaaggatagaaatgaaatatcacaa
aactgggcaatttcaagaagctttgctccagcgatggaagatgaaaagaaagaaaaactt
ataaaaggatggcataaggcagtaacaaaagcaatggattgggaagaaagagaataa

DBGET integrated database retrieval system