KEGG   Clostridium botulinum A ATCC 3502: CBO3071Help
Entry
CBO3071           CDS       T00533                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CBO3071 (ruvA)
Enzymes [BR:cbo01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     CBO3071 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3258387..3258980)
Genome map
AA seq 197 aa AA seqDB search
MYEYIKGKYIDMYKDYIVIENNNIGYKIYTSGSTMAKLPSIGENIMLYTEQIVREDFIGV
YGFLTKDELSMFKLLLTINGVGAKAALSLLSISNVSTLKYAIKMGDEKTITRAPGIGKKT
AQRIILELKDKIEIDILEEDDEQIINKVADDKKVLEAVAALVTLGYSEKEANKVINSCDK
NNSLEQIIKEALKYLMK
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaatatataaaaggaaaatatattgatatgtacaaagactatatagttatagaa
aataacaatataggttataagatatacacatcaggaagtactatggcaaaattaccttcc
ataggtgaaaatataatgttatatactgagcaaatagtaagagaagattttataggagtt
tatggatttttaacaaaagatgagttaagcatgtttaaattgcttttaacaataaatggg
gtaggggctaaggcagcgttatctttattatctataagcaatgtttctactttgaaatat
gctataaaaatgggagatgaaaaaactataacaagagctcctggtataggtaaaaaaaca
gctcaaagaattatattagagcttaaggataagatagagatagatattttagaagaagat
gatgaacaaatcataaataaggttgcggatgataaaaaagtattagaagcagtagctgct
ttagtaacactaggttattctgaaaaagaagcaaataaagtgattaattcatgtgataaa
aataattctttagaacagattataaaggaagctttaaaatatttaatgaaataa

DBGET integrated database retrieval system