KEGG   Clostridium botulinum A ATCC 3502: CBO3112Help
Entry
CBO3112           CDS       T00533                                 

Gene name
gtaB
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CBO3112 (gtaB)
   00052 Galactose metabolism
    CBO3112 (gtaB)
   00500 Starch and sucrose metabolism
    CBO3112 (gtaB)
   00520 Amino sugar and nucleotide sugar metabolism
    CBO3112 (gtaB)
Enzymes [BR:cbo01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     CBO3112 (gtaB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3307383..3308279)
Genome map
AA seq 298 aa AA seqDB search
MKVKKAIIPAAGLGTRFLPATKAQPKEMLPIVDKPTIQYIIEEAVKSGIEQILIITGRNK
RAIEDHFDKSVELEKELEEKGKAEMLSMVKDISNMAEIYYIRQKEPKGLGHAISCAKTFV
GNEPFAVMLGDDVVYSDKPCLKQLIKCYNEYQTTIVGVQEVPEEDVHKYGIVKGMFIEDR
IYKIKDLVEKPPKEEAPSNMAILGRYIISPAIFDILENTKPGKGGEIQLTDALRTLINKE
AMYAYNFEGRRYDVGDKLGFLQATVEYALRREKLNTNFVKYLQQLKNNEEFTALFKTE
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttaaaaaggccataattcctgcagcaggattgggaacaagatttttacctgca
actaaagctcaacctaaagaaatgttacctatagttgataaaccaactatacaatatata
atagaagaggctgtaaaatccggtatagaacaaatattaataataactggaagaaataaa
agagctatagaagatcatttcgataaatctgtagaattggaaaaggaattagaagaaaaa
ggtaaagctgaaatgctttctatggttaaggatatatctaatatggctgaaatatattat
ataagacaaaaagaacctaaaggattagggcatgctataagttgtgctaaaacttttgtt
ggcaatgaaccttttgcagtaatgttaggagacgatgtagtctatagtgataaaccatgc
ttgaagcagcttataaaatgctacaatgaatatcaaacaactatagtaggtgtacaagaa
gtaccagaggaagatgtacataaatatggtattgtgaaaggtatgtttatagaagataga
atatataaaataaaagatttagtagaaaaaccacctaaggaagaagctccatctaatatg
gctatattagggagatatattataagtcctgctatatttgatattttagaaaatacaaaa
ccaggtaaaggtggagaaatacagcttacagatgcattgagaacattgattaataaagag
gccatgtatgcatataattttgagggtagaagatatgatgttggagataaactaggattt
cttcaggctactgtagagtatgcactgagaagagaaaagttaaatacaaatttcgtcaaa
tatctacaacaattgaaaaataacgaagaatttacagcactatttaaaactgaataa

DBGET integrated database retrieval system