KEGG   Clostridium botulinum A ATCC 3502: CBO3343Help
Entry
CBO3343           CDS       T00533                                 

Definition
dipeptidase PepV
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
cbo  Clostridium botulinum A ATCC 3502
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cbo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    CBO3343
  Amino acid metabolism
   00300 Lysine biosynthesis
    CBO3343
Enzymes [BR:cbo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     CBO3343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3573000..3574391)
Genome map
AA seq 463 aa AA seqDB search
MEINKIIEELKDDLIDSTAELVKIKSIEDEAKEGKPYGEGVASALEKALEISEKLGFETV
NVDGYVGYAEYGEGDEYVGVLGHLDLVPEGDGWKYPPYGAEIHDGKMYGRGTTDDKGPIM
AALYGLKAIKESKLPLSKKVRILFGTNEETGSKEIEHYLEKEKPPVLGFTPDAEYPIIYA
EKGITIFDVVKKLEIKSSKAIKLKYIKGGEASNMVPDYCEAGIECPDTDMIIRSLEYCAN
RNGIELTAEEKGGLVVIKSFGLSAHGSTPEIGKNAIMQMFKFLAELPLGHCDELQFIRFF
NNNVGNETDGKTFGVELEDEPSGKLSFNVGTISMENNKIRMSLNLRYPVTYKSEDLMEKF
NKKIDGTGIKVENFEDQKPLYFDAEHQLIKSLQKVYKEQTGKEPELLAIGGGTYAKEMPN
MVAFGPLFPGEPDVIHKKDEYIELENLVLNAKIYGHAIYELAK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
ttggagataaataaaataatagaagagctaaaagatgatcttatagactctactgcagaa
ttagttaaaattaagagtatagaagatgaagcaaaggaaggtaaaccttatggggaaggc
gtagccagtgctttggaaaaagcattagaaataagtgaaaagctaggttttgaaactgta
aacgtagatggatatgttggatatgctgaatacggtgaaggtgatgaatatgtaggtgtt
ttaggtcatttggatttagtaccagaaggagatggatggaagtatccaccttatggagca
gaaatacatgatggaaaaatgtatggtagaggaactacagatgacaaggggcctataatg
gcagcactttacggtttaaaagccataaaagaatcaaaacttcctttatctaaaaaggtt
agaatcttgtttggaacaaatgaagaaacaggttctaaagaaatagaacattatttagaa
aaggaaaaaccaccagtacttggatttactccagatgctgagtatccaataatctatgct
gaaaaaggaattacaatatttgatgtagtaaaaaaattagaaataaaaagtagtaaagct
attaaattaaaatatattaaaggtggagaagcatctaatatggtgccagattattgtgaa
gctggtatagaatgtccagatacagatatgataataagatctttagagtattgtgctaat
agaaatgggatagaattaacagcagaagaaaaaggtggtttagtagtaattaaatctttt
ggactatccgctcatggaagtacaccagagattggtaagaatgctataatgcaaatgttt
aaatttttagcagaacttccattaggtcattgtgatgaattacaattcataagatttttt
aataataatgtaggaaatgaaactgatggtaaaacttttggtgtagagctagaagatgaa
ccatcaggtaagttaagttttaatgtaggaactatttctatggaaaataataaaataaga
atgtcattaaatttaagatatcctgtaacatataaatcagaagatcttatggaaaagttc
aataaaaagatagatggaacaggaataaaagtagaaaattttgaggatcaaaaaccttta
tattttgatgcagaacaccaattaataaaatcattacaaaaggtatataaagaacaaaca
ggaaaagaaccagaattactagctataggtggaggaacttatgcaaaagaaatgcctaat
atggttgcctttggaccacttttccctggagaaccagatgtaattcataaaaaagatgaa
tatatagaactagaaaacttggtgttaaatgccaaaatatacgggcatgctatatatgaa
ttagccaaatag

DBGET integrated database retrieval system