KEGG   Caulobacteraceae bacterium OTSz_A_272: ATE48_15195Help
Entry
ATE48_15195       CDS       T04422                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
cbot  Caulobacteraceae bacterium OTSz_A_272
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:cbot00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    ATE48_15195
   00630 Glyoxylate and dicarboxylate metabolism
    ATE48_15195
   00640 Propanoate metabolism
    ATE48_15195
   00650 Butanoate metabolism
    ATE48_15195
  Lipid metabolism
   00071 Fatty acid degradation
    ATE48_15195
   00072 Synthesis and degradation of ketone bodies
    ATE48_15195
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ATE48_15195
   00310 Lysine degradation
    ATE48_15195
   00380 Tryptophan metabolism
    ATE48_15195
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ATE48_15195
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ATE48_15195
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    ATE48_15195
Enzymes [BR:cbot01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ATE48_15195
Exosome [BR:cbot04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ATE48_15195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
2974524..2975738
Genome map
AA seq 404 aa AA seqDB search
MAEAYIYDAVRTPRGKGKSNGSLHEQTSLQLATQVLEAIRDRNNLDTSKVDDVYMGCLSP
IGEQGGNLPRIAVLNAGYAQTVAGVQVERFCASGLEACNIAAAKVKSGEAELAIGAGCES
MSRVPMGSTGGSWATDPSIAMKSYFTPQGVAADAIATKYGFSRTDLDSYAVQSQQRAAQA
WKENRFKKSIVPVKDQLGVTLLAHDEFMRPETTLQSLGALEPSFKMQGEVMPGFDGVIQQ
RYPEIEKIDHVHHAGNSSGIVDGAAGVLIGTKEMGEALGLKPRARILGGASIGSEPSIML
TGPEHVTAKLMKKLGLTKQDIDLWELNEAFAAVVLRWVQALDLDMAKVNVNGGAIAMGHP
IGATGAMILGTMVDELERADKERALITLCIGAGMGTATVIERVN
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atggctgaggcctatatttatgacgcggttcgcaccccgcgcggcaaaggcaagtcgaac
ggctcgctgcacgagcaaacgtcgctgcaattggcgacgcaagtgctcgaggcgatccgc
gatcgcaacaacctcgacacctcgaaagtcgatgacgtttacatgggctgcctctcaccg
atcggcgagcagggcggcaacctcccgcgtatcgccgtgctcaacgccggttacgcgcaa
accgtcgctggcgtgcaggtcgagcgcttctgcgcatctggccttgaagcctgcaacatc
gccgccgcgaaagtgaaatccggcgaagccgaactcgccatcggcgccggctgcgaaagc
atgagccgcgtaccgatgggctcgaccggcggttcatgggcgactgatccgtcgatcgcg
atgaaatcctacttcacgccgcaaggcgtcgccgccgacgcgatcgcaaccaagtacggc
ttctcgcgcaccgatcttgatagctacgcggtccaatcccagcagcgcgccgcgcaagcc
tggaaggaaaaccgcttcaagaagtcgatcgtgccggtgaaggatcaactcggcgtcacg
ctgctcgcgcacgacgaattcatgcgcccggaaactacgcttcaatcgctcggcgcgctt
gagcccagtttcaagatgcaaggcgaagtgatgcctggtttcgatggcgtcattcagcag
cgttatccggaaatcgaaaagatcgatcacgtccaccacgccggcaactcgtccggcatc
gttgacggcgccgctggtgttttgatcggcaccaaggaaatgggcgaagcgctcggcctg
aagccgcgcgcccgcatcctcggcggcgcttcgatcggctctgagccgtcaatcatgttg
acgggccctgagcacgtcacggcgaagctgatgaagaagctcggcctcaccaagcaagac
atcgacctctgggagctcaacgaagctttcgcggcggtcgtgctgcgctgggtccaagcg
ctcgatctcgatatggccaaggtcaacgtcaatggcggcgctatcgcgatgggtcacccc
attggcgcaaccggcgcgatgatcctcggcaccatggtcgatgaactcgaacgcgccgac
aaagaacgcgcgcttatcacgctctgcatcggcgccggcatgggcaccgcaaccgtgatc
gaacgggtgaactaa

DBGET integrated database retrieval system