KEGG   Caenorhabditis briggsae: CBG00036Help
Entry
CBG00036          CDS       T01054                                 

Gene name
Cbr-pcp-1.1
Definition
(RefSeq) C. briggsae CBR-PCP-1.1 protein
  KO
K01285  lysosomal Pro-X carboxypeptidase [EC:3.4.16.2]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.2  lysosomal Pro-Xaa carboxypeptidase
     CBG00036 (Cbr-pcp-1.1)
Peptidases [BR:cbr01002]
 Serine Peptidases
  Family S28
   CBG00036 (Cbr-pcp-1.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_S28 Abhydrolase_1 Peptidase_S9 Hydrolase_4
Motif
Other DBs
NCBI-GeneID: 8584648
NCBI-ProteinID: XP_002642654
WormBase: CBG00036
Position
III
AA seq 512 aa AA seqDB search
NYDFIPENIEVRWYKGMRLDHFTWGDTRTFDLRIMWNNTYYQPGGPIFFYTGNEGAVSTF
EVATGMMFDLAPMFNASIIFAEHRFYGATQPFGNQSYANLANVGYLTSEQALADYAELLT
ELKRDNNQFGKTFHRDSQVISFGGSYGGMLSAWFRQKYPHIVKGAWAGSAPLIYMHDGGV
DPGAFDNITSRTYVENGCNRFILANAWNAVLNLSSTDSGRAWLNNNPVFKLDPRTPINNQ
TDGWNLNAYMREAIEYMAMVDYPYPTGFLEPLPGWPVTVACGYMNATGESFSDQDLVTAV
ANAANVYYNYNQNANFTWCIDFNICGDQGTGGLGDDALGWPWQECSEIIMAMCASGGAND
VFWSECGDNIYDTLKQGCVSIFGSMKWTTANWNIDAVKTLYGYDLSGSSNLILTQGHLDP
WSGGGYKVDQTNTARGIYVMEIPGSAHHLDLRQPNTCDPNTVVNARYQIVQILKCWVDVN
CNTNPTISPLPTLSIPNVECKDRIGEYPWGQT
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
aactatgacttcatacccgaaaatattgaagtgcgctggtacaaaggcatgcgattggac
catttcacatggggagacaccagaacttttgatttgagaataatgtggaacaacacctac
taccaaccgggcggtcccatcttcttctacactggaaacgagggagcagtgtcgacattc
gaagttgcgactggaatgatgtttgacctggcaccaatgttcaatgcttccatcattttc
gccgagcacagattctacggagccactcagccattcggaaatcaatcttatgctaatcta
gccaatgttggatacttgactagtgaacaggctctggctgattatgcagaacttttgact
gagttgaagagagacaataatcaattcgggaagacgttccatagggattcacaagtcatt
tctttcggtggatcttacggtggaatgctgtccgcttggtttaggcaaaagtatccacat
attgtcaagggagcttgggctggttcggcacctctgatttacatgcacgatggaggtgtg
gatccaggagcattcgataatatcacatcaagaacttatgttgagaatggatgcaatagg
tttattctggcaaatgcttggaatgcagttctcaatctttcctctactgattctggtcgt
gcgtggctcaacaacaacccagtcttcaagctagatccacgtactccaatcaacaatcaa
actgatggatggaatctcaacgcctacatgcgtgaagccatcgaatacatggcaatggtt
gactatccatacccaaccgggttcttggagcctcttccaggttggccggttactgtagca
tgcggatatatgaacgccactggagaatcattctctgatcaggacttggtgacagcagtg
gccaatgcagcaaatgtttattacaattataaccaaaatgccaatttcacctggtgcatt
gattttaatatttgtggagatcaaggaaccggaggacttggggatgatgctctcggatgg
ccatggcaagaatgctcggaaatcataatggcgatgtgtgcatctggaggagctaatgac
gtcttctggtctgaatgtggagataatatttatgatacgctgaagcagggatgtgtttcg
attttcggaagtatgaagtggacaacagccaactggaatattgatgcagtaaagacgctc
tacggatatgacttgagtggatccagtaacctaatcttaacgcaaggacaccttgaccca
tggtctggaggcggttacaaagtcgaccaaaccaatactgcccgtggaatctatgtcatg
gaaattcccggttctgcacatcatttagatttgagacaaccaaatacttgtgatccgaat
acagtggttaatgctagatatcagatcgttcaaatcctgaaatgctgggttgacgtaaac
tgcaacaccaacccaaccatctctcctcttccaactctttcgattccaaacgtcgagtgc
aaagacagaattggagaatatccatggggacaaact

DBGET integrated database retrieval system