KEGG   Caenorhabditis briggsae: CBG00090Help
Entry
CBG00090          CDS       T01054                                 

Gene name
Cbr-ugt-50
Definition
C. briggsae CBR-UGT-50 protein
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
cbr  Caenorhabditis briggsae
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    CBG00090 (Cbr-ugt-50)
   00053 Ascorbate and aldarate metabolism
    CBG00090 (Cbr-ugt-50)
   00500 Starch and sucrose metabolism
    CBG00090 (Cbr-ugt-50)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    CBG00090 (Cbr-ugt-50)
   00860 Porphyrin and chlorophyll metabolism
    CBG00090 (Cbr-ugt-50)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    CBG00090 (Cbr-ugt-50)
   00982 Drug metabolism - cytochrome P450
    CBG00090 (Cbr-ugt-50)
   00983 Drug metabolism - other enzymes
    CBG00090 (Cbr-ugt-50)
Enzymes [BR:cbr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     CBG00090 (Cbr-ugt-50)
Glycosyltransferases [BR:cbr01003]
 Others
  Hydrophobic molecule
   CBG00090 (Cbr-ugt-50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
X
AA seq 519 aa AA seqDB search
YYSKMRVLLYCFAVILLECFIVGSAKILVYCPSISKSHVLFIPSYSSALNNFDGAKHANV
WRLHNVTHAYDAKLDSLANVMEDSHIGFLDRLTYDVDFWMEMCEDLARQHHRMQHLIDYG
FDLALFNDIDPCNSAIISLQVSQHLQDGATLQRGHHGQDCMGPRQDDDYGRKLITDRISG
LPMLPSYVPSIEENPNHDRMNFLERMSNAYKYFQSLVVHYLQERRVLHLFRNYISPDFPS
IMEIIRNVSVVFVNTDEMFDITRSYSQKFVFVGMLEAEKSKNETLPEKLNEYFSKGKLGS
VFVSFGTVTPFRVLPERIQLSVFNAIQKLPDYHFVVKTVIDDTTTAELFAGVPNVDLVNW
VPQTAILNHPNLKMFVSHGGMNSVLETMHHGIPMVIMPVFTDQFRNGKNVERRGAGKMVL
RQTVANETFYETMNEVLTDERYTKGAKRTSQLMKNRPFTPEERVSKWVDFIMTHDTSEQF
HLESNSFTFIEHNQLDIFFVFILLPLITFFVYRRFLKRK
NT seq 1557 nt NT seq  +upstreamnt  +downstreamnt
tactactccaaaatgagagtacttctctattgtttcgcggttattctacttgaatgcttc
attgtgggctctgcgaaaattctagtctattgtccatccattagcaaaagccacgtgcta
tttatcccttcctactcatctgcgctgaacaactttgacggtgcgaaacatgccaacgta
tggagacttcacaacgtcacccatgcgtacgacgccaagttggattcgttggccaacgtg
atggaagactcgcatattggattcctggatcgtctcacttatgatgtcgacttctggatg
gaaatgtgtgaagatcttgcaagacaacaccatcgaatgcaacatcttatcgactatgga
tttgatcttgccctcttcaacgacatcgacccttgcaactcggctattataagcttacag
gtctctcaacatctccaagacggtgctactctccagcgaggccatcatggacaagattgc
atgggacctaggcaagatgacgactatggcagaaaattgataacggatcggatttcagga
ctacccatgctgccgtcctatgtgcccagtatagaggagaacccaaaccacgatcgtatg
aacttcttggagcggatgtccaatgcatataaatattttcaatcccttgttgtccattat
ctccaagaaagacgtgttcttcatcttttccgaaattacatttctccggatttcccatca
attatggaaatcatccggaacgtatcagtggtttttgtcaatacggatgaaatgtttgac
ataacaagatcgtattctcagaaattcgtttttgtcggaatgcttgaagccgaaaaatca
aagaatgaaacacttcccgagaagctgaacgaatattttagcaaaggcaaattaggatct
gtttttgtttcctttggaactgtgactccgttccgtgtcctacccgagcgaattcaacta
tcagtttttaatgcgattcaaaaactgcctgattatcattttgtggtcaaaactgtcatt
gatgataccactaccgctgaactgttcgctggcgtaccaaatgttgatctagtgaactgg
gtaccacaaactgctatattaaatcaccctaacctgaaaatgtttgtttctcatggagga
atgaatagcgtgctggaaacaatgcatcatggaataccaatggttatcatgccagtgttt
acggatcagtttagaaatgggaagaatgtcgaacgtcgtggagctggaaagatggttcta
cggcaaacagttgctaatgaaactttctatgaaaccatgaacgaagttctcacagatgag
agatacacaaaaggtgctaaacggacgtcacaactaatgaaaaatcggccgttcactcca
gaagaaagagtctctaaatgggttgattttataatgacccatgatacatcagagcagttt
catttggagagcaatagtttcacattcatcgagcataatcagctagatattttctttgtt
tttatcctccttcctttaatcactttttttgtttacagacggtttctcaaaagaaag

DBGET integrated database retrieval system