KEGG   Caenorhabditis briggsae: CBG00142Help
Entry
CBG00142          CDS       T01054                                 

Definition
Hypothetical protein CBG00142
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cbr  Caenorhabditis briggsae
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:cbr00270]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 178 aa AA seqDB search
MAYFMANATRENCQDECRLSPNRDAVEEDLKKIGVECTKVDFDDANVQEDLDQLIKKYNM
NYHDEIHICRETMPNFDEKLKIFFEEHLHDDAELRVIKHGAGYFDVRAKDEQWIRIPVRR
GDFVFLPPGIYHRFTTDRSEDVVALRLFRNNPKWTAFNRSENGDKQPIREQYLKDVSA
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatttcatggcaaacgcaacgagagaaaattgtcaagacgagtgcagattgtct
ccgaatcgtgacgctgtagaggaagatttgaagaaaatcggggtggaatgcacaaaggtc
gatttcgatgacgcgaatgttcaagaagatttggatcaactcatcaaaaaatacaatatg
aattaccacgacgaaattcacatttgccgagagaccatgccaaactttgatgagaagttg
aaaatcttctttgaagagcatctccacgacgacgctgagctaagagtcattaaacacgga
gccggatattttgacgtgagagccaaggatgagcaatggattcgcattccagtccgtcgt
ggtgactttgtcttcttaccaccgggaatctatcatagattcactacggatcgctctgaa
gacgtcgttgctcttcgcctcttccgcaacaatccaaaatggactgctttcaacagaagt
gaaaacggagacaaacaaccaatccgagagcaatacttgaaagatgtttctgcataa

DBGET integrated database retrieval system