KEGG   Caenorhabditis briggsae: CBG00143Help
Entry
CBG00143          CDS       T01054                                 

Definition
Hypothetical protein CBG00143
Orthology
K12343  
3-oxo-5-alpha-steroid 4-dehydrogenase 1 [EC:1.3.1.22]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     CBG00143
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
X
AA seq 248 aa AA seqDB search
MIQLEEETILTMAWLMIASAIVVFAALRFGLTAGYGRYTNTARLGISPRLAWFIQEAPSF
FIPFYYLFNGTSNSGHYLTRVFLLHYFNRVFIFPLKIRSTTVSPLYIMLSAIFFCCYNGF
MQGYWNAFYQPEEGALTARHYIGSLLFFYGMYINHKADRILFNLRAPGETGYKIPEGWLY
EHISCPNYFGEIVEWTGYAIMAWNLPALAFAIFTASNIGPRAISHHAWYKEKFPEYPPHR
KALIPFLL
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgatccagttggaagaagaaaccatccttaccatggcttggctaatgatagccagtgcc
attgtggtctttgctgctttacgattcggattgactgctggatatggaagatacactaat
actgctcgtcttggaatcagtccacgattggcatggttcatccaagaggcaccgtctttc
ttcattcccttctactatctcttcaacggaacttccaactcaggacattatttgactcgt
gtcttccttctccactatttcaacagagtgttcatcttcccattaaaaattcgttccact
actgtttctccattgtacatcatgctgtcggcaattttcttctgctgctacaacggattt
atgcaaggatattggaatgccttttatcaaccagaagaaggagcgcttactgctcgtcat
tatattggatctctcctattcttctacggaatgtacatcaaccacaaggccgacagaatc
ctgttcaacttgagagctccaggagagactggatacaagattccagagggatggttgtat
gagcacatctcctgtccaaactactttggagaaattgtcgagtggaccggatacgcaatc
atggcctggaatcttccagctctcgccttcgccattttcaccgcttccaacatcggacca
cgagcgatcagtcatcatgcatggtacaaggaaaagttcccagagtatccaccacatcgg
aaggctctcatcccattccttttgtaa

DBGET integrated database retrieval system