KEGG   Caenorhabditis briggsae: CBG00336Help
Entry
CBG00336          CDS       T01054                                 

Definition
Hypothetical protein CBG00336
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cbr  Caenorhabditis briggsae
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:cbr03440]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 753 aa AA seqDB search
MSRVALNMDSYEGNDTPSVEIARFVVLYGKASTRKHKIWEGDGLLVCYGDSCMLKSEDER
DVICRPQCLSQNAPRSSPHSSTSTQPRRLQMALPTSSNKRYLHLFSTNRIFWIERRLLPS
SPRFARHLRDHQKEGIKFIFDRLKVGEGKKKWAERFWQTIWDWEKVYKRWQPRSKTVSQI
AQSCLIIVPSSLVNNWKSEFEKWWRLMRFPAVIALTAMDIKSYQTTIKTMPYLVISYDLA
QRHVEKLRACRFDVMVCDEGHKLKNLDGRLRKTLLSLEIPRRLILTGTPMQNDFDEFYSI
LNFVCPAKFDSLPRFRLMCNDDVEQLNEIIDECMLRRTAAGIPFSLPDEYILFCAASRIQ
KAIHSEICDYMTGDPLSLIFFARQLANHPKLLLDNLREKNSKTGEKSLKQAQKHTALLLA
FDGPNMPRGAAKESGKLYALADMLKCFRMLQECTVVVSNYIETLDMIEQLCAYLEFRVFR
LDGKTQVQDRQKLVRNFNDQRDPSNIFLLSTKAGGVGLNLIGASRLVLFDSDWNPANDQQ
AMARIWRDGQVRPCHIYRLITTGTIEEKMLQRQIKKTGLGCVIDAIEVGDTVSTFTDEDL
KDIFTFTGDDTECNTHDLCDCSCDGTGMLESEMDEETEEENNTVENMDPSFGLPKREDVA
GIMPEDDDVDDGDIANMEDFDEKVLKTDDVAKAPKKRNWDTSRTIASLAELSRWRHFSPR
HPDTWHHFMVNAGLSQVDTDVDLTFAFYQESKF
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgagtggcactcaatatggatagttatgaggggaatgacaccccatcggttgaa
atcgctcgttttgtggtgttatatggaaaagcgtcgactaggaaacacaaaatttgggag
ggcgatggtttgttggtgtgctatggcgattcgtgtatgctgaaatcggaggatgagcgg
gatgtgatttgcagaccccaatgtctctcccaaaacgctccacgttcgtccccccactca
tcgacgtcaacgcaacctcgtcggctccagatggctcttccaacgtcatccaacaaaaga
tacctccatttattctcaacgaacaggatattctggatagaaagacgtcttctgccatca
tcgcccagattcgcacgtcatctgagagatcatcagaaggagggaatcaagtttatattc
gatagattgaaggtgggagagggaaagaagaaatgggcggagcgattctggcagacgata
tgggactgggaaaaagtatacaaacgatggcagccacgctccaagaccgtatcccaaatt
gctcaatcttgccttatcatcgtcccatcctccctcgtgaacaactggaaatcggaattc
gaaaaatggtggagactgatgagattcccagctgtcatcgccctcacagccatggatatc
aaatcgtatcagacgacgatcaaaacgatgccctatctagttatcagttatgatttggct
caacgccacgtggaaaagttgagagcttgccggttcgatgtgatggtgtgtgatgagggg
cataagctgaagaatttggatggacggttgaggaaaacgctcctctccctggaaattcca
cgtcgtttgatcctcaccggcacgccgatgcaaaacgatttcgacgaattctactcgatt
ctgaattttgtgtgccccgcgaaattcgattccctccccagattccgtctgatgtgcaat
gacgatgtggagcaactcaatgagattatcgatgagtgtatgctgagaagaactgcggcc
ggaatccccttttctcttccagatgagtacatcctattctgtgcggcgtctcgaatccaa
aaagcgattcactcggaaatctgtgactacatgactggtgatcccctatcattgatcttc
ttcgctcgtcagctggccaatcatcccaaacttttgctggataatttgagagagaaaaat
tcaaaaaccggagaaaaatctctgaaacaagcccagaaacataccgccttactattggcc
ttcgatggaccgaatatgccacgtggcgccgcgaaggaatccggaaaactttacgctctg
gcagacatgctaaaatgcttccgaatgcttcaagagtgtactgtagtcgtttcgaactac
atcgaaacattggacatgatcgaacagttgtgtgcgtatttggagtttcgtgtctttcga
ttggatggaaagactcaggtccaagatcgtcagaaactggtccgaaacttcaatgatcaa
cgggacccatccaacatcttcctgttgagcacaaaagccggtggagttggactcaatctc
atcggagcatctcgtttggttctgtttgattccgattggaatccggcgaatgatcaacag
gcgatggcgagaatttggagagacggacaagtcaggccatgtcatatttatcgattgatt
actacgggaacaatcgaagagaaaatgctgcaaagacaaattaagaaaaccggattggga
tgtgtgattgacgccattgaagtaggagacaccgtctccacattcaccgacgaagatctc
aaggacattttcacattcaccggcgacgacaccgaatgtaacacgcacgatctctgtgat
tgctcatgcgacggcaccggaatgttggaatctgaaatggacgaagaaacagaagaagaa
aacaatactgtagagaacatggacccatcgtttgggcttccaaaacgagaagacgtcgct
ggaatcatgccagaagatgatgatgtggatgatggagatatcgcgaatatggaagatttc
gatgaaaaggttttgaagactgatgacgtggcaaaagctccgaagaagagaaattgggat
acctctcgtaccatcgcctcactcgccgagctatcccgctggcgccatttctccccacgt
catccggacacgtggcatcacttcatggtcaacgctggactctcccaggtggacactgat
gttgacctcactttcgccttctaccaggaatcgaagttttga

DBGET integrated database retrieval system