KEGG   Caenorhabditis briggsae: CBG00336Help
Entry
CBG00336          CDS       T01054                                 

Definition
Hypothetical protein CBG00336
Orthology
K10877  
DNA repair and recombination protein RAD54B [EC:3.6.4.-]
Organism
cbr  Caenorhabditis briggsae
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    CBG00336
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.-  
     CBG00336
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 753 aa AA seqDB search
MSRVALNMDSYEGNDTPSVEIARFVVLYGKASTRKHKIWEGDGLLVCYGDSCMLKSEDER
DVICRPQCLSQNAPRSSPHSSTSTQPRRLQMALPTSSNKRYLHLFSTNRIFWIERRLLPS
SPRFARHLRDHQKEGIKFIFDRLKVGEGKKKWAERFWQTIWDWEKVYKRWQPRSKTVSQI
AQSCLIIVPSSLVNNWKSEFEKWWRLMRFPAVIALTAMDIKSYQTTIKTMPYLVISYDLA
QRHVEKLRACRFDVMVCDEGHKLKNLDGRLRKTLLSLEIPRRLILTGTPMQNDFDEFYSI
LNFVCPAKFDSLPRFRLMCNDDVEQLNEIIDECMLRRTAAGIPFSLPDEYILFCAASRIQ
KAIHSEICDYMTGDPLSLIFFARQLANHPKLLLDNLREKNSKTGEKSLKQAQKHTALLLA
FDGPNMPRGAAKESGKLYALADMLKCFRMLQECTVVVSNYIETLDMIEQLCAYLEFRVFR
LDGKTQVQDRQKLVRNFNDQRDPSNIFLLSTKAGGVGLNLIGASRLVLFDSDWNPANDQQ
AMARIWRDGQVRPCHIYRLITTGTIEEKMLQRQIKKTGLGCVIDAIEVGDTVSTFTDEDL
KDIFTFTGDDTECNTHDLCDCSCDGTGMLESEMDEETEEENNTVENMDPSFGLPKREDVA
GIMPEDDDVDDGDIANMEDFDEKVLKTDDVAKAPKKRNWDTSRTIASLAELSRWRHFSPR
HPDTWHHFMVNAGLSQVDTDVDLTFAFYQESKF
NT seq 2262 nt NT seq  +upstreamnt  +downstreamnt
atgtcacgagtggcactcaatatggatagttatgaggggaatgacaccccatcggttgaa
atcgctcgttttgtggtgttatatggaaaagcgtcgactaggaaacacaaaatttgggag
ggcgatggtttgttggtgtgctatggcgattcgtgtatgctgaaatcggaggatgagcgg
gatgtgatttgcagaccccaatgtctctcccaaaacgctccacgttcgtccccccactca
tcgacgtcaacgcaacctcgtcggctccagatggctcttccaacgtcatccaacaaaaga
tacctccatttattctcaacgaacaggatattctggatagaaagacgtcttctgccatca
tcgcccagattcgcacgtcatctgagagatcatcagaaggagggaatcaagtttatattc
gatagattgaaggtgggagagggaaagaagaaatgggcggagcgattctggcagacgata
tgggactgggaaaaagtatacaaacgatggcagccacgctccaagaccgtatcccaaatt
gctcaatcttgccttatcatcgtcccatcctccctcgtgaacaactggaaatcggaattc
gaaaaatggtggagactgatgagattcccagctgtcatcgccctcacagccatggatatc
aaatcgtatcagacgacgatcaaaacgatgccctatctagttatcagttatgatttggct
caacgccacgtggaaaagttgagagcttgccggttcgatgtgatggtgtgtgatgagggg
cataagctgaagaatttggatggacggttgaggaaaacgctcctctccctggaaattcca
cgtcgtttgatcctcaccggcacgccgatgcaaaacgatttcgacgaattctactcgatt
ctgaattttgtgtgccccgcgaaattcgattccctccccagattccgtctgatgtgcaat
gacgatgtggagcaactcaatgagattatcgatgagtgtatgctgagaagaactgcggcc
ggaatccccttttctcttccagatgagtacatcctattctgtgcggcgtctcgaatccaa
aaagcgattcactcggaaatctgtgactacatgactggtgatcccctatcattgatcttc
ttcgctcgtcagctggccaatcatcccaaacttttgctggataatttgagagagaaaaat
tcaaaaaccggagaaaaatctctgaaacaagcccagaaacataccgccttactattggcc
ttcgatggaccgaatatgccacgtggcgccgcgaaggaatccggaaaactttacgctctg
gcagacatgctaaaatgcttccgaatgcttcaagagtgtactgtagtcgtttcgaactac
atcgaaacattggacatgatcgaacagttgtgtgcgtatttggagtttcgtgtctttcga
ttggatggaaagactcaggtccaagatcgtcagaaactggtccgaaacttcaatgatcaa
cgggacccatccaacatcttcctgttgagcacaaaagccggtggagttggactcaatctc
atcggagcatctcgtttggttctgtttgattccgattggaatccggcgaatgatcaacag
gcgatggcgagaatttggagagacggacaagtcaggccatgtcatatttatcgattgatt
actacgggaacaatcgaagagaaaatgctgcaaagacaaattaagaaaaccggattggga
tgtgtgattgacgccattgaagtaggagacaccgtctccacattcaccgacgaagatctc
aaggacattttcacattcaccggcgacgacaccgaatgtaacacgcacgatctctgtgat
tgctcatgcgacggcaccggaatgttggaatctgaaatggacgaagaaacagaagaagaa
aacaatactgtagagaacatggacccatcgtttgggcttccaaaacgagaagacgtcgct
ggaatcatgccagaagatgatgatgtggatgatggagatatcgcgaatatggaagatttc
gatgaaaaggttttgaagactgatgacgtggcaaaagctccgaagaagagaaattgggat
acctctcgtaccatcgcctcactcgccgagctatcccgctggcgccatttctccccacgt
catccggacacgtggcatcacttcatggtcaacgctggactctcccaggtggacactgat
gttgacctcactttcgccttctaccaggaatcgaagttttga

DBGET integrated database retrieval system