KEGG   Caenorhabditis briggsae: CBG00344Help
Entry
CBG00344          CDS       T01054                                 

Definition
Hypothetical protein CBG00344
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
cbr  Caenorhabditis briggsae
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:cbr00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
IV
AA seq 418 aa AA seqDB search
MILRVFAIFATIFVAVSSKKVEQVHLSLSGKQDEMMVTWLTQDPLPNVTPYVAFGVTKDA
LRLTAKGNSTGWADQGKKKVMRYTHRATMNSLVPGQVYYYQVGSSQAMSDVFHFRQPDQS
LPLRAAIFGDLSIYKGQQSIDQLIAARKNNQFDLIIHIGDLAYDLHDNDGDNGDDYMNAI
QDFAAYVPYMVFAGNHEVDSNFNQIVNRFTMPKNGVYDNNLFWSFDYGFVHFIALNSEYY
AEEMSKETQLQYKWLENDLAGNSKKWTIVMFHRPWYCSSKKKKGCHDDQDILSRDGLKDK
FPGLEELLNKYKVDLILYGHKHTYERMWPIFNAQPFKSQDPGHIKNAPAPVYILTGGAGC
HSHEDPSDHIIQDFSVKALGEYGYTFLTVYNSTHLSTDYVDTSETSGEFLDPFVLEKD
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgattcttcgagtttttgctatttttgctacaatctttgtagctgtgagctctaaaaaa
gtggagcaagttcatttgagtttgagtggaaaacaagatgagatgatggtgacgtggctg
acacaggatccattacccaatgtgactccctacgtagcattcggtgtcaccaaagatgct
ctacggctaactgccaaaggaaattctacaggctgggcggaccagggaaagaagaaggtt
atgagatacacccatcgagcaactatgaacagtttggtgcctggacaagtttattactac
caagtcggaagttcccaagcgatgtccgatgttttccacttccggcaacctgaccaatcc
ttgccacttcgtgccgcgattttcggagatttgagcatctacaaaggacagcaatcgatt
gatcaattgatcgcagcgagaaaaaataatcaatttgatttgatcatccacatcggggac
ttggcatatgacctacacgataatgatggggacaatggtgatgattatatgaatgccatt
caagattttgcggcatatgtgccttatatggtatttgctggaaaccatgaagtcgatagt
aacttcaatcaaattgtcaatcgattcaccatgcccaaaaatggcgtatacgataataat
ctcttctggagttttgactatggcttcgtgcattttatcgccctgaactccgaatattac
gctgaggaaatgtccaaggagactcaacttcagtacaaatggctagaaaacgatctagct
ggaaattcaaagaagtggacaatcgtgatgttccatcgaccttggtattgttccagcaag
aagaagaagggatgtcatgatgaccaggatattctatcgagggacggattgaaggataag
ttcccaggattggaggaattgttgaataagtacaaagtggatttgattctctatgggcac
aaacacacttatgagagaatgtggccaattttcaatgctcagccattcaaatcacaggat
ccggggcatatcaaaaatgcgccagcgccggtctatatattgacgggaggagcgggttgt
cattcccacgaggacccctccgatcacatcattcaagatttttctgtgaaagcccttgga
gaatatggatacacttttttgacggtctacaattctacacacttgtccactgattacgtg
gatacttctgaaacgagcggagagtttttggatccttttgtgctggagaaggattga

DBGET integrated database retrieval system