KEGG   Caenorhabditis briggsae: CBG00430Help
Entry
CBG00430          CDS       T01054                                 

Gene name
Cbr-nas-6
Definition
C. briggsae CBR-NAS-6 protein
Orthology
K08076  
astacin [EC:3.4.24.21]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.21  astacin
     CBG00430 (Cbr-nas-6)
Peptidases [BR:cbr01002]
 Metallo Peptidases
  Family M12: astacin/adamalysin family
   CBG00430 (Cbr-nas-6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 252 aa AA seqDB search
MDTAFSPNEVKIMEKAFDSYRRNTCIRFEKREGQTDYLNIVKGYGCYSQVGRTGGKQEIS
LGRGCFFHEIIVHELMHSVGFWHEHSRADRDDHIKILWDNILPGMKSQFDKISAVLQDLQ
GENYDYKSIMHYDSTAFSRNGRNTIETVEDGFTQVIGTNQDLSELDIINKLYSCKAKKKE
KMRVTTEEPRRLIPQVGEKKPVDSGEKCVDHFADCPHFAQYCTRASFFFVMKSYCPFTCK
HCPGDRKIKKSG
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atggatacggctttctcaccgaatgaagtgaagattatggaaaaggctttcgacagttac
cgaaggaatacctgtattcgatttgagaaacgagaaggacaaactgattatttaaatatt
gtcaaaggatacggatgctattctcaagttggaagaacgggaggaaaacaagaaatctca
ctgggaagaggttgtttcttccatgaaattattgttcatgagttgatgcattccgttggt
ttctggcacgaacactctagagctgatcgtgacgatcatataaagatactgtgggataat
atcttgcccggaatgaaatcacaatttgacaaaatttcggcagtgttacaggatctacaa
ggcgaaaactacgattacaagtctataatgcattatgatagtactgcgttctctcgaaat
ggtcggaacacaatcgaaactgtagaagatggattcactcaggtcattggtacgaatcaa
gatttgtcggaactagatattatcaacaaactgtactcatgcaaggcaaagaagaaggag
aaaatgagagtaacgactgaagaaccaaggagattgattccccaagtcggagagaagaag
cctgtcgattcaggagagaaatgtgtcgaccactttgccgattgtccacatttcgctcaa
tattgcactcgagcgtccttcttcttcgtcatgaaatcatactgtccattcacgtgcaag
cattgtcccggtgataggaaaatcaaaaagtcgggataa

DBGET integrated database retrieval system