KEGG   Caenorhabditis briggsae: CBG00434Help
Entry
CBG00434          CDS       T01054                                 

Definition
Hypothetical protein CBG00434
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cbr  Caenorhabditis briggsae
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cbr00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    CBG00434
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    CBG00434
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    CBG00434
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     CBG00434
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
Position
IV
AA seq 520 aa AA seqDB search
MREWKEVIWILSVFVCSVLSSPCNSKIYDGAFKNLVCVCNATSCDEIEPIGEIGEGKAVV
YRSTLDGDRLKRMSMKMGQKLGKDEVVNVTISIDASERFQQIFGFGGAFTDSAGEQLFAV
SEKVQEQIINSYFGEYGLEYNVGRVPIASCDFSTHEYSYDDVGEDFELKHFGLAEEDLKL
KIPFIQKAIEKTKGKLQLFASPWSAPGWMKTTGRMRGGGAMRNDTRVYEAYSNYFIKFFE
AYSSHSIPFWGLTIQNEPSTGADMTWRWQTMNYTAETMRDFLKNYLGPKLKGNKLTESLK
VMILDDGRGLLPGWADTIFNDTESTKYADGIAVHWYGNLYSPAVLLDIAQRHHPDKFIFG
TEACAGYFGHHGPIMGDWFRAESYADDILTDLNHHVTGWTDWNLCLDETGGPNWAYNVVD
APIIVNRTAKEFYKQPMFYALGHFSKFLPRGSTRVFTKVDGNLAVSAVSVVIEGGQRVTV
MLSKSSNSLLTRVVDSATGYSLVLTLPPRSIHTVIWNKRK
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagagaatggaaagaagttatttggatattgtccgtttttgtatgttcagttctttcc
tctccgtgcaattctaaaatctacgatggcgcatttaaaaatttggtctgcgtctgcaat
gctacttcatgcgatgaaattgaaccaattggagagattggtgaaggaaaagcagtggtg
tatagatcaacattggatggtgatagacttaaaagaatgagtatgaaaatgggacaaaag
ttgggtaaagatgaagttgtgaatgtaacaatctcgattgatgcgagtgaacggttccaa
cagatttttggattcggaggagctttcactgactccgctggtgaacagctttttgcggtg
tctgaaaaagttcaagaacaaattatcaattcatattttggagagtatggactggaatat
aatgttggcagagttcctatagctagttgtgatttttcaactcatgaatatagttatgat
gatgttggtgaagattttgaattgaaacatttcggattagcagaagaggatttgaagttg
aagattcctttcattcaaaaagcaattgagaagacgaagggaaaacttcaactatttgcc
agtccttggtcagcacccggatggatgaaaacaacaggaaggatgagaggtggtggagca
atgagaaacgatacgcgagtttatgaagcatattcgaactattttataaaattcttcgaa
gcatactcatctcattctattccattttggggacttacaattcaaaatgagccatcgaca
ggagccgatatgacatggagatggcaaactatgaactacacagccgaaactatgagagac
tttttgaaaaactatttaggtccaaaactgaaaggaaacaagttaacagaatctttgaaa
gtaatgattttggatgatggaagaggattgttacctggatgggctgataccattttcaat
gacactgaaagcactaaatatgccgatggaattgctgtacactggtatggaaacttgtac
tctccagctgtattgctagatattgcacagagacatcacccggataagtttatttttgga
accgaggcttgcgctggctatttcggccatcacggcccaatcatgggcgactggttccga
gcggaaagttatgcagatgatattttaaccgatcttaaccatcacgtcactggatggact
gattggaatttgtgtcttgatgaaacgggcggtcccaattgggcatacaatgtggttgat
gctccgatcattgtgaatcgtactgcgaaagagttttacaagcaacccatgttttacgca
ttgggacattttagtaaattcctgccacgtggatctactcgagtattcacaaaagtggac
ggaaacctagcagtatctgcagtgagtgtggtgattgaaggaggccagcgtgttacagta
atgctgtcaaaatcttcaaactctttgctcactcgtgtggtggatagcgcaactggatat
tctcttgtactgactttaccgccaagatctattcatactgtcatttggaataaaagaaaa
taa

DBGET integrated database retrieval system