KEGG   Caenorhabditis briggsae: CBG00486Help
Entry
CBG00486          CDS       T01054                                 

Definition
Hypothetical protein CBG00486
Orthology
K15235  
josephin [EC:3.4.19.12]
Organism
cbr  Caenorhabditis briggsae
Brite
Enzymes [BR:cbr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     CBG00486
Peptidases [BR:cbr01002]
 Cysteine Peptidases
  Family C86
   CBG00486
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
WormBase: 
UniProt: 
Position
III
AA seq 173 aa AA seqDB search
MTSPPNLYHEKQKLQYCLIHTVNNILQKKEFDATKMDEICYGMNESKWFNPHRSWIGTGN
YDANILIAALQKHNLKVVWFDKRLGVEKIKFEKLRAIVFNIPSRTLLTLYRGRHWFAVVQ
KNEKFYNLDSKLSAPTVIAEIANFTKNHVDSGDSEVMLVVEQDVDEDTVVEKI
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcaccgccgaatttgtaccatgagaagcagaaactacagtactgcctcatccac
acagtaaataatattctgcaaaaaaaggagttcgatgcgacgaaaatggacgagatttgc
tatgggatgaacgagagtaaatggttcaatccgcatagatcttggatcggtaccggcaac
tatgacgccaacattcttatagccgccctacagaagcacaacttgaaggtcgtctggttt
gacaagcgtctaggtgtggagaagatcaaattcgaaaaattacgcgccatcgtttttaat
ataccctccaggaccctgctgactctctacagaggccgtcactggtttgcggtggtccag
aaaaacgaaaaattctacaacttggactccaaactgagcgcgcctacagtaatcgcggaa
attgcgaatttcacaaaaaaccacgtggattctggagattcagaagtgatgttggtcgtg
gagcaggatgtggacgaggatactgtagtcgagaaaatttga

DBGET integrated database retrieval system